Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | PWK66_RS06970 | Genome accession | NZ_CP118482 |
| Coordinates | 1380087..1380266 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 20160179 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1380087..1420704 | 1380087..1380266 | within | 0 |
Gene organization within MGE regions
Location: 1380087..1420704
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWK66_RS06970 (PWK66_06910) | prx | 1380087..1380266 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| PWK66_RS06975 (PWK66_06915) | sda1 | 1380505..1381677 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| PWK66_RS06980 (PWK66_06920) | - | 1381793..1382989 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| PWK66_RS06985 (PWK66_06925) | - | 1383100..1383285 (-) | 186 | WP_002988802.1 | holin | - |
| PWK66_RS06990 (PWK66_06930) | - | 1383282..1383581 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| PWK66_RS06995 (PWK66_06935) | - | 1383592..1384212 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| PWK66_RS07000 (PWK66_06940) | - | 1384215..1384376 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| PWK66_RS07005 (PWK66_06945) | - | 1384385..1386292 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| PWK66_RS07010 (PWK66_06950) | - | 1386303..1386938 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| PWK66_RS07015 (PWK66_06955) | - | 1386938..1387993 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| PWK66_RS07020 (PWK66_06960) | - | 1387990..1389972 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| PWK66_RS07025 (PWK66_06965) | - | 1389982..1390824 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| PWK66_RS07030 (PWK66_06970) | - | 1390836..1395218 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| PWK66_RS07035 (PWK66_06975) | - | 1395233..1395466 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| PWK66_RS07040 (PWK66_06980) | - | 1395541..1395996 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| PWK66_RS07045 (PWK66_06985) | - | 1396050..1396649 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| PWK66_RS07050 (PWK66_06990) | - | 1396661..1397020 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| PWK66_RS07055 (PWK66_06995) | - | 1397024..1397368 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PWK66_RS07060 (PWK66_07000) | - | 1397365..1397643 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| PWK66_RS07065 (PWK66_07005) | - | 1397654..1398010 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| PWK66_RS07070 (PWK66_07010) | - | 1398022..1398909 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| PWK66_RS07075 (PWK66_07015) | - | 1398922..1399491 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| PWK66_RS07080 (PWK66_07020) | - | 1399647..1399913 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| PWK66_RS07085 (PWK66_07025) | - | 1399916..1400104 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| PWK66_RS07090 (PWK66_07030) | - | 1400135..1401580 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| PWK66_RS07095 (PWK66_07035) | - | 1401540..1403072 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| PWK66_RS07100 (PWK66_07040) | - | 1403088..1404365 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| PWK66_RS07105 (PWK66_07045) | - | 1404355..1404807 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| PWK66_RS07110 (PWK66_07050) | - | 1404897..1405313 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| PWK66_RS07115 (PWK66_07055) | - | 1405310..1405501 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| PWK66_RS07120 (PWK66_07060) | - | 1405491..1406342 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| PWK66_RS07125 (PWK66_07065) | - | 1406351..1406617 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| PWK66_RS07130 (PWK66_07070) | - | 1406614..1406781 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| PWK66_RS07135 (PWK66_07075) | - | 1406782..1408104 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| PWK66_RS07140 (PWK66_07080) | - | 1408101..1408376 (-) | 276 | WP_032461521.1 | VRR-NUC domain-containing protein | - |
| PWK66_RS07145 (PWK66_07085) | - | 1408763..1411147 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| PWK66_RS07150 (PWK66_07090) | - | 1411152..1413074 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| PWK66_RS07155 (PWK66_07095) | - | 1413117..1413674 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| PWK66_RS07160 (PWK66_07100) | - | 1413685..1414083 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| PWK66_RS07165 (PWK66_07105) | - | 1414087..1415241 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| PWK66_RS07170 (PWK66_07110) | - | 1415241..1415540 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| PWK66_RS07175 (PWK66_07115) | - | 1415628..1415831 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| PWK66_RS07180 (PWK66_07120) | - | 1415977..1416363 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| PWK66_RS07185 (PWK66_07125) | - | 1416360..1416563 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| PWK66_RS07190 (PWK66_07130) | - | 1416556..1416726 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| PWK66_RS07195 (PWK66_07135) | - | 1416723..1416998 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| PWK66_RS07200 (PWK66_07140) | - | 1417060..1417275 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| PWK66_RS07205 (PWK66_07145) | - | 1417323..1417736 (+) | 414 | WP_032461522.1 | hypothetical protein | - |
| PWK66_RS07210 (PWK66_07150) | - | 1417721..1417873 (-) | 153 | WP_011527730.1 | hypothetical protein | - |
| PWK66_RS07215 (PWK66_07155) | - | 1418199..1418549 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| PWK66_RS07220 (PWK66_07160) | - | 1418563..1418946 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PWK66_RS07225 (PWK66_07165) | - | 1418957..1419508 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| PWK66_RS07230 (PWK66_07170) | - | 1419625..1420704 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=792734 PWK66_RS06970 WP_002988813.1 1380087..1380266(-) (prx) [Streptococcus pyogenes strain 20160179]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=792734 PWK66_RS06970 WP_002988813.1 1380087..1380266(-) (prx) [Streptococcus pyogenes strain 20160179]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |