Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | PWK65_RS06965 | Genome accession | NZ_CP118481 |
| Coordinates | 1376708..1376887 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 20185322 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1376708..1418192 | 1376708..1376887 | within | 0 |
Gene organization within MGE regions
Location: 1376708..1418192
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWK65_RS06965 (PWK65_06900) | prx | 1376708..1376887 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| PWK65_RS06970 (PWK65_06905) | sda1 | 1377126..1378298 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| PWK65_RS06975 (PWK65_06910) | - | 1378414..1379610 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| PWK65_RS06980 (PWK65_06915) | - | 1379721..1379906 (-) | 186 | WP_002988802.1 | holin | - |
| PWK65_RS06985 (PWK65_06920) | - | 1379903..1380202 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| PWK65_RS06990 (PWK65_06925) | - | 1380213..1380833 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| PWK65_RS06995 (PWK65_06930) | - | 1380836..1380997 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| PWK65_RS07000 (PWK65_06935) | - | 1381006..1382913 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| PWK65_RS07005 (PWK65_06940) | - | 1382924..1383559 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| PWK65_RS07010 (PWK65_06945) | - | 1383559..1384614 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| PWK65_RS07015 (PWK65_06950) | - | 1384611..1386593 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| PWK65_RS07020 (PWK65_06955) | - | 1386603..1387445 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| PWK65_RS07025 (PWK65_06960) | - | 1387457..1391839 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| PWK65_RS07030 (PWK65_06965) | - | 1391854..1392087 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| PWK65_RS07035 (PWK65_06970) | - | 1392162..1392617 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| PWK65_RS07040 (PWK65_06975) | - | 1392671..1393270 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| PWK65_RS07045 (PWK65_06980) | - | 1393282..1393641 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| PWK65_RS07050 (PWK65_06985) | - | 1393645..1393989 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PWK65_RS07055 (PWK65_06990) | - | 1393986..1394264 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| PWK65_RS07060 (PWK65_06995) | - | 1394275..1394631 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| PWK65_RS07065 (PWK65_07000) | - | 1394643..1395428 (-) | 786 | WP_397610609.1 | phage capsid protein | - |
| PWK65_RS07070 (PWK65_07005) | - | 1395441..1396010 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| PWK65_RS07075 (PWK65_07010) | - | 1396166..1396432 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| PWK65_RS07080 (PWK65_07015) | - | 1396435..1396623 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| PWK65_RS07085 (PWK65_07020) | - | 1396654..1398099 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| PWK65_RS07090 (PWK65_07025) | - | 1398059..1399591 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| PWK65_RS07095 (PWK65_07030) | - | 1399607..1400884 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| PWK65_RS07100 (PWK65_07035) | - | 1400874..1401326 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| PWK65_RS07105 (PWK65_07040) | - | 1401416..1401832 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| PWK65_RS07110 (PWK65_07045) | - | 1401829..1402020 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| PWK65_RS07115 (PWK65_07050) | - | 1402010..1402861 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| PWK65_RS07120 (PWK65_07055) | - | 1402870..1403136 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| PWK65_RS07125 (PWK65_07060) | - | 1403133..1403300 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| PWK65_RS07130 (PWK65_07065) | - | 1403301..1404623 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| PWK65_RS07135 (PWK65_07070) | - | 1404620..1404895 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| PWK65_RS07140 (PWK65_07075) | - | 1405009..1405872 (-) | 864 | WP_002987985.1 | IS982-like element ISSpy2 family transposase | - |
| PWK65_RS07145 (PWK65_07080) | - | 1406251..1408635 (-) | 2385 | WP_002988726.1 | phage/plasmid primase, P4 family | - |
| PWK65_RS07150 (PWK65_07085) | - | 1408640..1410562 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| PWK65_RS07155 (PWK65_07090) | - | 1410605..1411162 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| PWK65_RS07160 (PWK65_07095) | - | 1411173..1411571 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| PWK65_RS07165 (PWK65_07100) | - | 1411575..1412729 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| PWK65_RS07170 (PWK65_07105) | - | 1412729..1413028 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| PWK65_RS07175 (PWK65_07110) | - | 1413116..1413319 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| PWK65_RS07180 (PWK65_07115) | - | 1413466..1413852 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| PWK65_RS07185 (PWK65_07120) | - | 1413849..1414052 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| PWK65_RS07190 (PWK65_07125) | - | 1414045..1414215 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| PWK65_RS07195 (PWK65_07130) | - | 1414212..1414487 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| PWK65_RS07200 (PWK65_07135) | - | 1414549..1414764 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| PWK65_RS07205 (PWK65_07140) | - | 1414812..1415225 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| PWK65_RS07210 (PWK65_07145) | - | 1415206..1415361 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| PWK65_RS07215 (PWK65_07150) | - | 1415636..1416037 (+) | 402 | WP_011285676.1 | helix-turn-helix domain-containing protein | - |
| PWK65_RS07220 (PWK65_07155) | - | 1416051..1416434 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PWK65_RS07225 (PWK65_07160) | - | 1416445..1416996 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| PWK65_RS07230 (PWK65_07165) | - | 1417113..1418192 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=792682 PWK65_RS06965 WP_002988813.1 1376708..1376887(-) (prx) [Streptococcus pyogenes strain 20185322]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=792682 PWK65_RS06965 WP_002988813.1 1376708..1376887(-) (prx) [Streptococcus pyogenes strain 20185322]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |