Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK54_RS08670 | Genome accession | NZ_CP118312 |
| Coordinates | 1659774..1659953 (-) | Length | 59 a.a. |
| NCBI ID | WP_038432505.1 | Uniprot ID | A0A8B6IX98 |
| Organism | Streptococcus pyogenes strain 20181688 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1658664..1705168 | 1659774..1659953 | within | 0 |
Gene organization within MGE regions
Location: 1658664..1705168
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK54_RS08660 (PVK54_08615) | - | 1658664..1658885 (-) | 222 | WP_002988211.1 | helix-turn-helix domain-containing protein | - |
| PVK54_RS08665 (PVK54_08620) | - | 1659055..1659429 (+) | 375 | WP_002988207.1 | helix-turn-helix domain-containing protein | - |
| PVK54_RS08670 (PVK54_08625) | prx | 1659774..1659953 (-) | 180 | WP_038432505.1 | hypothetical protein | Regulator |
| PVK54_RS08675 (PVK54_08630) | - | 1660156..1660395 (+) | 240 | WP_003055856.1 | hypothetical protein | - |
| PVK54_RS08680 (PVK54_08635) | - | 1660434..1660733 (+) | 300 | WP_247522168.1 | hypothetical protein | - |
| PVK54_RS08685 (PVK54_08640) | - | 1660910..1661266 (+) | 357 | WP_003055891.1 | hypothetical protein | - |
| PVK54_RS08690 (PVK54_08645) | acrIIA3 | 1661399..1661773 (+) | 375 | WP_023611744.1 | anti-CRISPR protein AcrIIA3 | - |
| PVK54_RS08695 (PVK54_08650) | - | 1661773..1662375 (+) | 603 | WP_023611748.1 | AP endonuclease | - |
| PVK54_RS08700 (PVK54_08655) | - | 1662377..1662592 (+) | 216 | WP_023611751.1 | hypothetical protein | - |
| PVK54_RS08705 (PVK54_08660) | - | 1662661..1662900 (+) | 240 | WP_003055855.1 | hypothetical protein | - |
| PVK54_RS08710 (PVK54_08665) | - | 1663086..1664288 (-) | 1203 | WP_023611747.1 | glucosaminidase domain-containing protein | - |
| PVK54_RS08715 (PVK54_08670) | - | 1664405..1664632 (-) | 228 | WP_000609113.1 | phage holin | - |
| PVK54_RS08720 (PVK54_08675) | - | 1664629..1664904 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| PVK54_RS08725 (PVK54_08680) | - | 1664914..1665531 (-) | 618 | WP_032461328.1 | DUF1366 domain-containing protein | - |
| PVK54_RS08730 (PVK54_08685) | - | 1665534..1665965 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| PVK54_RS08735 (PVK54_08690) | - | 1665977..1667863 (-) | 1887 | WP_136073798.1 | gp58-like family protein | - |
| PVK54_RS08740 (PVK54_08695) | - | 1667874..1668188 (-) | 315 | WP_063812987.1 | hypothetical protein | - |
| PVK54_RS08745 (PVK54_08700) | - | 1668190..1669413 (-) | 1224 | WP_030127718.1 | hypothetical protein | - |
| PVK54_RS08750 (PVK54_08705) | - | 1669410..1671464 (-) | 2055 | WP_136073784.1 | phage tail spike protein | - |
| PVK54_RS08755 (PVK54_08710) | - | 1671461..1672240 (-) | 780 | WP_397611410.1 | distal tail protein Dit | - |
| PVK54_RS08760 (PVK54_08715) | - | 1672273..1675908 (-) | 3636 | WP_010922222.1 | tape measure protein | - |
| PVK54_RS08765 (PVK54_08720) | - | 1675923..1676252 (-) | 330 | WP_346393435.1 | hypothetical protein | - |
| PVK54_RS08770 (PVK54_08725) | - | 1676294..1676647 (-) | 354 | WP_002990023.1 | tail assembly chaperone | - |
| PVK54_RS08775 (PVK54_08730) | - | 1676707..1677273 (-) | 567 | WP_010922221.1 | phage major tail protein, TP901-1 family | - |
| PVK54_RS08780 (PVK54_08735) | - | 1677370..1677759 (-) | 390 | WP_002990026.1 | hypothetical protein | - |
| PVK54_RS08785 (PVK54_08740) | - | 1677756..1678121 (-) | 366 | WP_002984399.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PVK54_RS08790 (PVK54_08745) | - | 1678102..1678410 (-) | 309 | WP_002990028.1 | hypothetical protein | - |
| PVK54_RS08795 (PVK54_08750) | - | 1678407..1678760 (-) | 354 | WP_002990030.1 | phage head-tail connector protein | - |
| PVK54_RS08800 (PVK54_08755) | - | 1678772..1679038 (-) | 267 | WP_002990031.1 | HeH/LEM domain-containing protein | - |
| PVK54_RS08805 (PVK54_08760) | - | 1679050..1680099 (-) | 1050 | WP_002990034.1 | major capsid protein | - |
| PVK54_RS08810 (PVK54_08765) | - | 1680102..1680482 (-) | 381 | WP_002990036.1 | structural protein | - |
| PVK54_RS08815 (PVK54_08770) | - | 1680492..1681025 (-) | 534 | WP_002990039.1 | DUF4355 domain-containing protein | - |
| PVK54_RS08820 (PVK54_08775) | - | 1681169..1681435 (-) | 267 | WP_002988396.1 | hypothetical protein | - |
| PVK54_RS08825 (PVK54_08780) | - | 1681821..1682006 (-) | 186 | WP_002988389.1 | hypothetical protein | - |
| PVK54_RS08830 (PVK54_08785) | - | 1682010..1683572 (-) | 1563 | WP_002988386.1 | phage head morphogenesis protein | - |
| PVK54_RS08835 (PVK54_08790) | - | 1683553..1685055 (-) | 1503 | WP_002988384.1 | phage portal protein | - |
| PVK54_RS08840 (PVK54_08795) | - | 1685067..1686356 (-) | 1290 | WP_002988380.1 | PBSX family phage terminase large subunit | - |
| PVK54_RS08845 (PVK54_08800) | - | 1686334..1686816 (-) | 483 | WP_002990047.1 | terminase small subunit | - |
| PVK54_RS08850 (PVK54_08805) | - | 1687022..1687234 (+) | 213 | WP_002990048.1 | hypothetical protein | - |
| PVK54_RS08855 (PVK54_08810) | - | 1687324..1688238 (-) | 915 | WP_002990050.1 | hypothetical protein | - |
| PVK54_RS08860 (PVK54_08815) | - | 1688553..1688993 (-) | 441 | WP_002990052.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PVK54_RS08865 (PVK54_08820) | - | 1689443..1689904 (-) | 462 | WP_002990055.1 | DUF1642 domain-containing protein | - |
| PVK54_RS08870 (PVK54_08825) | - | 1689901..1690194 (-) | 294 | WP_032460172.1 | hypothetical protein | - |
| PVK54_RS08875 (PVK54_08830) | - | 1690242..1691006 (-) | 765 | WP_023077953.1 | site-specific DNA-methyltransferase | - |
| PVK54_RS08880 (PVK54_08835) | - | 1690996..1691478 (-) | 483 | WP_115222940.1 | class I SAM-dependent methyltransferase | - |
| PVK54_RS08885 (PVK54_08840) | - | 1691482..1691766 (-) | 285 | WP_115222942.1 | hypothetical protein | - |
| PVK54_RS08890 (PVK54_08845) | - | 1691763..1691927 (-) | 165 | WP_002986864.1 | hypothetical protein | - |
| PVK54_RS08895 (PVK54_08850) | - | 1691924..1692094 (-) | 171 | WP_002986866.1 | hypothetical protein | - |
| PVK54_RS08900 (PVK54_08855) | - | 1692091..1692504 (-) | 414 | WP_136059424.1 | YopX family protein | - |
| PVK54_RS08905 (PVK54_08860) | - | 1692514..1692783 (-) | 270 | WP_002987593.1 | hypothetical protein | - |
| PVK54_RS08910 (PVK54_08865) | - | 1692780..1693064 (-) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| PVK54_RS08915 (PVK54_08870) | - | 1693058..1693255 (-) | 198 | WP_011017567.1 | hypothetical protein | - |
| PVK54_RS08920 (PVK54_08875) | - | 1693242..1693754 (-) | 513 | WP_002985380.1 | hypothetical protein | - |
| PVK54_RS08925 (PVK54_08880) | - | 1693751..1694092 (-) | 342 | WP_002985383.1 | hypothetical protein | - |
| PVK54_RS08930 (PVK54_08885) | - | 1694269..1695066 (-) | 798 | WP_394377487.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| PVK54_RS08935 (PVK54_08890) | - | 1695063..1695992 (-) | 930 | WP_136059418.1 | recombinase RecT | - |
| PVK54_RS08940 (PVK54_08895) | - | 1695995..1696324 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| PVK54_RS08945 (PVK54_08900) | - | 1696346..1696600 (-) | 255 | WP_063629029.1 | hypothetical protein | - |
| PVK54_RS08950 (PVK54_08905) | - | 1696587..1696934 (-) | 348 | WP_063629028.1 | hypothetical protein | - |
| PVK54_RS08955 (PVK54_08910) | - | 1696947..1697084 (-) | 138 | WP_011285580.1 | hypothetical protein | - |
| PVK54_RS08960 (PVK54_08915) | - | 1697084..1697926 (-) | 843 | WP_063629027.1 | ATP-binding protein | - |
| PVK54_RS08965 (PVK54_08920) | - | 1697936..1698844 (-) | 909 | WP_115223080.1 | phage replisome organizer N-terminal domain-containing protein | - |
| PVK54_RS08970 (PVK54_08925) | - | 1698858..1699172 (-) | 315 | WP_136059419.1 | helix-turn-helix domain-containing protein | - |
| PVK54_RS08975 (PVK54_08930) | - | 1699188..1699325 (-) | 138 | WP_168389432.1 | hypothetical protein | - |
| PVK54_RS08980 (PVK54_08935) | - | 1699322..1699579 (-) | 258 | WP_012560977.1 | hypothetical protein | - |
| PVK54_RS08985 (PVK54_08940) | - | 1699782..1700123 (-) | 342 | WP_136059420.1 | hypothetical protein | - |
| PVK54_RS08990 (PVK54_08945) | - | 1700192..1700578 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| PVK54_RS08995 (PVK54_08950) | - | 1700567..1700776 (-) | 210 | WP_136059421.1 | hypothetical protein | - |
| PVK54_RS09000 (PVK54_08955) | - | 1700827..1701633 (+) | 807 | WP_136059422.1 | TIGR02391 family protein | - |
| PVK54_RS09005 (PVK54_08960) | - | 1701845..1702057 (-) | 213 | WP_115223078.1 | helix-turn-helix transcriptional regulator | - |
| PVK54_RS09010 (PVK54_08965) | - | 1702347..1702709 (+) | 363 | WP_115223077.1 | helix-turn-helix domain-containing protein | - |
| PVK54_RS09015 (PVK54_08970) | - | 1702714..1703064 (+) | 351 | WP_115223076.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PVK54_RS09020 (PVK54_08975) | - | 1703079..1703504 (+) | 426 | WP_115223075.1 | hypothetical protein | - |
| PVK54_RS09025 (PVK54_08980) | - | 1703644..1703910 (+) | 267 | WP_063632653.1 | hypothetical protein | - |
| PVK54_RS09030 (PVK54_08985) | - | 1704032..1705168 (+) | 1137 | WP_012560981.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6792.86 Da Isoelectric Point: 4.0650
>NTDB_id=791822 PVK54_RS08670 WP_038432505.1 1659774..1659953(-) (prx) [Streptococcus pyogenes strain 20181688]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVLMELR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPGEPVRPWEVMTVEVAGEVLMELR
Nucleotide
Download Length: 180 bp
>NTDB_id=791822 PVK54_RS08670 WP_038432505.1 1659774..1659953(-) (prx) [Streptococcus pyogenes strain 20181688]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
TGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGCTAATGGAATTGAGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
TGGACAGATTTTTGATTATGTTTTGCCCGGTGAGCCTGTGAGACCGTGGGAGGTTATGACAGTTGAAGTAGCGGGAGAAG
TGCTAATGGAATTGAGGTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
98.305 |
0.729 |
| prx | Streptococcus pyogenes MGAS315 |
90.476 |
71.186 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
69.492 |
0.593 |
| prx | Streptococcus pyogenes MGAS315 |
75.61 |
69.492 |
0.525 |