Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK54_RS07515 | Genome accession | NZ_CP118312 |
| Coordinates | 1461993..1462172 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 20181688 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1461993..1502609 | 1461993..1462172 | within | 0 |
Gene organization within MGE regions
Location: 1461993..1502609
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK54_RS07515 (PVK54_07470) | prx | 1461993..1462172 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| PVK54_RS07520 (PVK54_07475) | sda1 | 1462411..1463583 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| PVK54_RS07525 (PVK54_07480) | - | 1463699..1464895 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| PVK54_RS07530 (PVK54_07485) | - | 1465006..1465191 (-) | 186 | WP_002988802.1 | holin | - |
| PVK54_RS07535 (PVK54_07490) | - | 1465188..1465487 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| PVK54_RS07540 (PVK54_07495) | - | 1465498..1466118 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| PVK54_RS07545 (PVK54_07500) | - | 1466121..1466282 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| PVK54_RS07550 (PVK54_07505) | - | 1466291..1468198 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| PVK54_RS07555 (PVK54_07510) | - | 1468209..1468844 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| PVK54_RS07560 (PVK54_07515) | - | 1468844..1469899 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| PVK54_RS07565 (PVK54_07520) | - | 1469896..1471878 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| PVK54_RS07570 (PVK54_07525) | - | 1471888..1472730 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| PVK54_RS07575 (PVK54_07530) | - | 1472742..1477124 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| PVK54_RS07580 (PVK54_07535) | - | 1477139..1477372 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| PVK54_RS07585 (PVK54_07540) | - | 1477447..1477902 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| PVK54_RS07590 (PVK54_07545) | - | 1477956..1478555 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| PVK54_RS07595 (PVK54_07550) | - | 1478567..1478926 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| PVK54_RS07600 (PVK54_07555) | - | 1478930..1479274 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PVK54_RS07605 (PVK54_07560) | - | 1479271..1479549 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| PVK54_RS07610 (PVK54_07565) | - | 1479560..1479916 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| PVK54_RS07615 (PVK54_07570) | - | 1479928..1480815 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| PVK54_RS07620 (PVK54_07575) | - | 1480828..1481397 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| PVK54_RS07625 (PVK54_07580) | - | 1481553..1481819 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| PVK54_RS07630 (PVK54_07585) | - | 1481822..1482010 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| PVK54_RS07635 (PVK54_07590) | - | 1482041..1483486 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| PVK54_RS07640 (PVK54_07595) | - | 1483446..1484978 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| PVK54_RS07645 (PVK54_07600) | - | 1484994..1486271 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| PVK54_RS07650 (PVK54_07605) | - | 1486261..1486713 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| PVK54_RS07655 (PVK54_07610) | - | 1486803..1487219 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| PVK54_RS07660 (PVK54_07615) | - | 1487216..1487407 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| PVK54_RS07665 (PVK54_07620) | - | 1487397..1488248 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| PVK54_RS07670 (PVK54_07625) | - | 1488257..1488523 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| PVK54_RS07675 (PVK54_07630) | - | 1488520..1488687 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| PVK54_RS07680 (PVK54_07635) | - | 1488688..1490010 (-) | 1323 | WP_397610630.1 | SNF2-related protein | - |
| PVK54_RS07685 (PVK54_07640) | - | 1490007..1490282 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| PVK54_RS07690 (PVK54_07645) | - | 1490669..1493053 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| PVK54_RS07695 (PVK54_07650) | - | 1493058..1494980 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| PVK54_RS07700 (PVK54_07655) | - | 1495023..1495580 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| PVK54_RS07705 (PVK54_07660) | - | 1495591..1495989 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| PVK54_RS07710 (PVK54_07665) | - | 1495993..1497147 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| PVK54_RS07715 (PVK54_07670) | - | 1497147..1497446 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| PVK54_RS07720 (PVK54_07675) | - | 1497534..1497737 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| PVK54_RS07725 (PVK54_07680) | - | 1497734..1497886 (-) | 153 | WP_011285675.1 | hypothetical protein | - |
| PVK54_RS07730 (PVK54_07685) | - | 1497883..1498269 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| PVK54_RS07735 (PVK54_07690) | - | 1498266..1498469 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| PVK54_RS07740 (PVK54_07695) | - | 1498462..1498632 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| PVK54_RS07745 (PVK54_07700) | - | 1498629..1498904 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| PVK54_RS07750 (PVK54_07705) | - | 1498966..1499181 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| PVK54_RS07755 (PVK54_07710) | - | 1499229..1499642 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| PVK54_RS07760 (PVK54_07715) | - | 1499623..1499778 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| PVK54_RS07765 (PVK54_07720) | - | 1500053..1500454 (+) | 402 | WP_011285676.1 | helix-turn-helix domain-containing protein | - |
| PVK54_RS07770 (PVK54_07725) | - | 1500468..1500851 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PVK54_RS07775 (PVK54_07730) | - | 1500862..1501413 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| PVK54_RS07780 (PVK54_07735) | - | 1501530..1502609 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=791816 PVK54_RS07515 WP_002988813.1 1461993..1462172(-) (prx) [Streptococcus pyogenes strain 20181688]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=791816 PVK54_RS07515 WP_002988813.1 1461993..1462172(-) (prx) [Streptococcus pyogenes strain 20181688]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |