Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK54_RS05050 | Genome accession | NZ_CP118312 |
| Coordinates | 940375..940557 (+) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes strain 20181688 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 901670..945897 | 940375..940557 | within | 0 |
| IS/Tn | 941401..942534 | 940375..940557 | flank | 844 |
Gene organization within MGE regions
Location: 901670..945897
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK54_RS04765 (PVK54_04720) | - | 901670..902866 (-) | 1197 | WP_011017350.1 | site-specific integrase | - |
| PVK54_RS04770 (PVK54_04725) | - | 903177..903917 (-) | 741 | WP_397611453.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| PVK54_RS04775 (PVK54_04730) | - | 903928..904284 (-) | 357 | WP_136105345.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PVK54_RS04780 (PVK54_04735) | - | 904289..904645 (-) | 357 | WP_168625481.1 | helix-turn-helix transcriptional regulator | - |
| PVK54_RS04785 (PVK54_04740) | - | 904932..905201 (+) | 270 | WP_397611456.1 | hypothetical protein | - |
| PVK54_RS04790 (PVK54_04745) | - | 905187..905585 (-) | 399 | WP_048327232.1 | DUF2513 domain-containing protein | - |
| PVK54_RS04795 (PVK54_04750) | - | 905637..905840 (+) | 204 | WP_015984784.1 | hypothetical protein | - |
| PVK54_RS04800 (PVK54_04755) | - | 905973..906692 (+) | 720 | WP_397611458.1 | ORF6C domain-containing protein | - |
| PVK54_RS04805 (PVK54_04760) | - | 906766..907023 (+) | 258 | WP_022554795.1 | hypothetical protein | - |
| PVK54_RS04810 (PVK54_04765) | - | 907097..907324 (+) | 228 | WP_397611461.1 | hypothetical protein | - |
| PVK54_RS04815 (PVK54_04770) | - | 907318..908229 (+) | 912 | WP_397611463.1 | DnaD domain protein | - |
| PVK54_RS04820 (PVK54_04775) | - | 908265..908492 (+) | 228 | WP_397611465.1 | hypothetical protein | - |
| PVK54_RS04825 (PVK54_04780) | - | 908492..908866 (+) | 375 | WP_397611467.1 | YopX family protein | - |
| PVK54_RS04830 (PVK54_04785) | - | 908863..909147 (+) | 285 | WP_397611468.1 | hypothetical protein | - |
| PVK54_RS04835 (PVK54_04790) | - | 909150..909485 (+) | 336 | WP_011054813.1 | hypothetical protein | - |
| PVK54_RS04840 (PVK54_04795) | - | 909488..909970 (+) | 483 | WP_136019356.1 | class I SAM-dependent methyltransferase | - |
| PVK54_RS04845 (PVK54_04800) | - | 909960..910724 (+) | 765 | WP_397611471.1 | DNA-methyltransferase | - |
| PVK54_RS04850 (PVK54_04805) | - | 910772..911371 (+) | 600 | WP_397611473.1 | DUF1642 domain-containing protein | - |
| PVK54_RS04855 (PVK54_04810) | - | 911368..911535 (+) | 168 | WP_397611475.1 | hypothetical protein | - |
| PVK54_RS04860 (PVK54_04815) | ssbA | 911694..912086 (+) | 393 | WP_397611477.1 | single-stranded DNA-binding protein | Machinery gene |
| PVK54_RS04865 (PVK54_04820) | - | 912101..912382 (+) | 282 | WP_397611479.1 | hypothetical protein | - |
| PVK54_RS04870 (PVK54_04825) | - | 912379..912717 (+) | 339 | WP_371935506.1 | helix-turn-helix domain-containing protein | - |
| PVK54_RS04875 (PVK54_04830) | - | 912720..913547 (+) | 828 | WP_011017372.1 | prohibitin family protein | - |
| PVK54_RS04880 (PVK54_04835) | - | 913562..913963 (+) | 402 | WP_155961725.1 | transcriptional regulator | - |
| PVK54_RS04885 (PVK54_04840) | - | 914123..914698 (+) | 576 | WP_011054435.1 | site-specific integrase | - |
| PVK54_RS04890 (PVK54_04845) | - | 914850..915272 (+) | 423 | WP_397611482.1 | hypothetical protein | - |
| PVK54_RS04895 (PVK54_04850) | - | 915253..915639 (+) | 387 | WP_243096355.1 | hypothetical protein | - |
| PVK54_RS04900 (PVK54_04855) | - | 915632..915937 (+) | 306 | WP_397611484.1 | HNH endonuclease | - |
| PVK54_RS04905 (PVK54_04860) | - | 916077..916394 (+) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| PVK54_RS04910 (PVK54_04865) | - | 916407..918137 (+) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| PVK54_RS04915 (PVK54_04870) | - | 918140..918352 (+) | 213 | WP_136260634.1 | hypothetical protein | - |
| PVK54_RS04920 (PVK54_04875) | - | 918505..919692 (+) | 1188 | WP_063633115.1 | phage portal protein | - |
| PVK54_RS04925 (PVK54_04880) | - | 919673..920479 (+) | 807 | WP_063808242.1 | head maturation protease, ClpP-related | - |
| PVK54_RS04930 (PVK54_04885) | - | 920496..921629 (+) | 1134 | WP_063808241.1 | phage major capsid protein | - |
| PVK54_RS04935 (PVK54_04890) | - | 921640..921813 (+) | 174 | WP_165363099.1 | hypothetical protein | - |
| PVK54_RS04940 (PVK54_04895) | - | 921813..922121 (+) | 309 | WP_063633118.1 | hypothetical protein | - |
| PVK54_RS04945 (PVK54_04900) | - | 922114..922476 (+) | 363 | WP_063633119.1 | hypothetical protein | - |
| PVK54_RS04950 (PVK54_04905) | - | 922478..922876 (+) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| PVK54_RS04955 (PVK54_04910) | - | 922869..923249 (+) | 381 | WP_063633120.1 | hypothetical protein | - |
| PVK54_RS04960 (PVK54_04915) | - | 923261..923845 (+) | 585 | WP_063633121.1 | major tail protein | - |
| PVK54_RS04965 (PVK54_04920) | gpG | 923938..924240 (+) | 303 | WP_063633122.1 | phage tail assembly chaperone G | - |
| PVK54_RS04970 (PVK54_04925) | - | 924466..928566 (+) | 4101 | WP_063633123.1 | phage tail tape measure protein | - |
| PVK54_RS04975 (PVK54_04930) | - | 928579..929349 (+) | 771 | WP_063808240.1 | distal tail protein Dit | - |
| PVK54_RS04980 (PVK54_04935) | - | 929346..931400 (+) | 2055 | WP_129820709.1 | phage tail spike protein | - |
| PVK54_RS04985 (PVK54_04940) | - | 931400..932674 (+) | 1275 | WP_063808246.1 | collagen-like protein | - |
| PVK54_RS04990 (PVK54_04945) | - | 932677..933324 (+) | 648 | WP_063808247.1 | hypothetical protein | - |
| PVK54_RS04995 (PVK54_04950) | - | 933335..935371 (+) | 2037 | WP_063812361.1 | gp58-like family protein | - |
| PVK54_RS05000 (PVK54_04955) | - | 935383..935811 (+) | 429 | WP_011018112.1 | DUF1617 family protein | - |
| PVK54_RS05005 (PVK54_04960) | - | 935814..936431 (+) | 618 | WP_029714007.1 | DUF1366 domain-containing protein | - |
| PVK54_RS05010 (PVK54_04965) | - | 936442..936741 (+) | 300 | WP_011018110.1 | hypothetical protein | - |
| PVK54_RS05015 (PVK54_04970) | - | 936738..936923 (+) | 186 | WP_011184796.1 | holin | - |
| PVK54_RS05020 (PVK54_04975) | - | 937036..938241 (+) | 1206 | WP_063629047.1 | glucosaminidase domain-containing protein | - |
| PVK54_RS05025 (PVK54_04980) | - | 938358..938714 (-) | 357 | WP_063808249.1 | hypothetical protein | - |
| PVK54_RS05030 (PVK54_04985) | - | 938772..939011 (-) | 240 | WP_011054447.1 | hypothetical protein | - |
| PVK54_RS05035 (PVK54_04990) | - | 939275..939526 (-) | 252 | WP_011054448.1 | hypothetical protein | - |
| PVK54_RS05040 (PVK54_04995) | - | 939667..939813 (-) | 147 | WP_011054449.1 | hypothetical protein | - |
| PVK54_RS05045 (PVK54_05000) | - | 939967..940176 (+) | 210 | WP_011054450.1 | helix-turn-helix domain-containing protein | - |
| PVK54_RS05050 (PVK54_05005) | prx | 940375..940557 (+) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
| PVK54_RS05055 (PVK54_05010) | - | 940846..941355 (+) | 510 | Protein_949 | nucleoside-diphosphate kinase | - |
| PVK54_RS05060 (PVK54_05015) | - | 941401..942534 (+) | 1134 | WP_000564846.1 | ISAs1-like element IS1548 family transposase | - |
| PVK54_RS05065 (PVK54_05025) | lepA | 942703..944535 (+) | 1833 | WP_002989943.1 | translation elongation factor 4 | - |
| PVK54_RS05070 (PVK54_05030) | slc2 | 944818..945897 (+) | 1080 | WP_019418810.1 | LPXTG-anchored collagen-like adhesin Scl2/SclB | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
>NTDB_id=791804 PVK54_RS05050 WP_029714017.1 940375..940557(+) (prx) [Streptococcus pyogenes strain 20181688]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=791804 PVK54_RS05050 WP_029714017.1 940375..940557(+) (prx) [Streptococcus pyogenes strain 20181688]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |