Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK50_RS05090 | Genome accession | NZ_CP118311 |
| Coordinates | 983297..983485 (+) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 20164915 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 946625..985608 | 983297..983485 | within | 0 |
Gene organization within MGE regions
Location: 946625..985608
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK50_RS04805 (PVK50_04765) | - | 946625..947245 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| PVK50_RS04810 (PVK50_04770) | - | 947608..948696 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| PVK50_RS04815 (PVK50_04775) | - | 948817..949710 (-) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| PVK50_RS04820 (PVK50_04780) | - | 949746..950570 (-) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| PVK50_RS04825 (PVK50_04785) | - | 950927..951085 (+) | 159 | WP_011285583.1 | hypothetical protein | - |
| PVK50_RS04830 (PVK50_04790) | - | 951115..951714 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| PVK50_RS04835 (PVK50_04795) | - | 951768..951977 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| PVK50_RS04840 (PVK50_04800) | - | 951966..952352 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| PVK50_RS04845 (PVK50_04805) | - | 952426..952626 (+) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| PVK50_RS04850 (PVK50_04810) | - | 952736..952945 (-) | 210 | WP_011017885.1 | hypothetical protein | - |
| PVK50_RS04855 (PVK50_04815) | - | 953076..953444 (-) | 369 | WP_015055958.1 | hypothetical protein | - |
| PVK50_RS04860 (PVK50_04820) | - | 953549..953737 (+) | 189 | Protein_901 | XRE family transcriptional regulator | - |
| PVK50_RS04865 (PVK50_04825) | - | 953751..954581 (+) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| PVK50_RS04870 (PVK50_04830) | - | 954568..955350 (+) | 783 | WP_011285581.1 | ATP-binding protein | - |
| PVK50_RS04875 (PVK50_04835) | - | 955341..955478 (+) | 138 | WP_011285580.1 | hypothetical protein | - |
| PVK50_RS04880 (PVK50_04840) | - | 955491..955844 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| PVK50_RS04885 (PVK50_04845) | - | 955825..956079 (+) | 255 | WP_011285578.1 | hypothetical protein | - |
| PVK50_RS04890 (PVK50_04850) | - | 956101..956583 (+) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| PVK50_RS04895 (PVK50_04855) | - | 956584..956694 (+) | 111 | Protein_908 | single-stranded DNA-binding protein | - |
| PVK50_RS04900 | - | 956809..957054 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| PVK50_RS04905 (PVK50_04860) | - | 957054..957290 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| PVK50_RS04910 (PVK50_04865) | - | 957287..957457 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| PVK50_RS04915 (PVK50_04870) | - | 957454..957738 (+) | 285 | WP_011018134.1 | hypothetical protein | - |
| PVK50_RS04920 (PVK50_04875) | - | 957740..958372 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| PVK50_RS04925 (PVK50_04880) | - | 958375..958899 (+) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| PVK50_RS04930 (PVK50_04885) | - | 958896..959162 (+) | 267 | WP_011018131.1 | hypothetical protein | - |
| PVK50_RS04935 (PVK50_04890) | - | 959448..959882 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PVK50_RS04940 (PVK50_04895) | - | 960492..960872 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| PVK50_RS04945 (PVK50_04900) | - | 960862..962136 (+) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| PVK50_RS04950 (PVK50_04905) | - | 962136..963461 (+) | 1326 | WP_011285570.1 | phage portal protein | - |
| PVK50_RS04955 (PVK50_04910) | - | 963430..964338 (+) | 909 | WP_011285569.1 | minor capsid protein | - |
| PVK50_RS04960 (PVK50_04915) | - | 964345..964614 (+) | 270 | WP_011285568.1 | hypothetical protein | - |
| PVK50_RS04965 (PVK50_04920) | - | 964616..964750 (+) | 135 | WP_015055956.1 | hypothetical protein | - |
| PVK50_RS04970 (PVK50_04925) | - | 964859..965428 (+) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| PVK50_RS04975 (PVK50_04930) | - | 965447..966337 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| PVK50_RS04980 (PVK50_04935) | - | 966350..966643 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| PVK50_RS04985 (PVK50_04940) | - | 966657..967001 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| PVK50_RS04990 (PVK50_04945) | - | 966998..967309 (+) | 312 | WP_011285567.1 | hypothetical protein | - |
| PVK50_RS04995 (PVK50_04950) | - | 967306..967701 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| PVK50_RS05000 (PVK50_04955) | - | 967703..968113 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| PVK50_RS05005 (PVK50_04960) | - | 968125..968631 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| PVK50_RS05010 (PVK50_04965) | - | 968644..968961 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| PVK50_RS05015 (PVK50_04970) | - | 968934..969392 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| PVK50_RS05020 (PVK50_04975) | - | 969385..971190 (+) | 1806 | WP_011054802.1 | tail protein | - |
| PVK50_RS05025 (PVK50_04980) | - | 971191..972675 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| PVK50_RS05030 (PVK50_04985) | - | 972676..976116 (+) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| PVK50_RS05035 (PVK50_04990) | - | 976121..977983 (+) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| PVK50_RS05040 (PVK50_04995) | - | 977994..978341 (+) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| PVK50_RS05045 (PVK50_05000) | - | 978355..978477 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| PVK50_RS05050 (PVK50_05005) | - | 978491..978814 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| PVK50_RS05055 (PVK50_05010) | - | 978814..979146 (+) | 333 | WP_011285562.1 | phage holin | - |
| PVK50_RS05060 (PVK50_05015) | - | 979148..979912 (+) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| PVK50_RS05065 (PVK50_05020) | - | 979924..980526 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| PVK50_RS05070 (PVK50_05025) | - | 980537..981310 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| PVK50_RS05075 (PVK50_05030) | - | 981320..981541 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| PVK50_RS05080 (PVK50_05035) | - | 981541..982200 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| PVK50_RS05085 (PVK50_05040) | speA | 982322..983077 (-) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| PVK50_RS05090 (PVK50_05045) | prx | 983297..983485 (+) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| PVK50_RS05100 (PVK50_05055) | - | 984076..984690 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| PVK50_RS05105 (PVK50_05060) | - | 984823..985608 (-) | 786 | WP_002989610.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=791754 PVK50_RS05090 WP_011285559.1 983297..983485(+) (prx) [Streptococcus pyogenes strain 20164915]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=791754 PVK50_RS05090 WP_011285559.1 983297..983485(+) (prx) [Streptococcus pyogenes strain 20164915]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |