Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK50_RS02995 | Genome accession | NZ_CP118311 |
| Coordinates | 571081..571260 (+) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 20164915 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 515979..579143 | 571081..571260 | within | 0 |
Gene organization within MGE regions
Location: 515979..579143
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK50_RS02690 (PVK50_02655) | ftsE | 516978..517670 (+) | 693 | WP_002985455.1 | cell division ATP-binding protein FtsE | - |
| PVK50_RS02695 (PVK50_02660) | ftsX | 517663..518592 (+) | 930 | WP_002990498.1 | permease-like cell division protein FtsX | - |
| PVK50_RS02700 (PVK50_02665) | - | 518901..519536 (-) | 636 | WP_002990496.1 | MBL fold metallo-hydrolase | - |
| PVK50_RS02705 (PVK50_02670) | - | 519767..520531 (+) | 765 | WP_002990495.1 | (S)-acetoin forming diacetyl reductase | - |
| PVK50_RS02710 (PVK50_02675) | - | 520681..523140 (+) | 2460 | WP_032461507.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
| PVK50_RS02715 (PVK50_02680) | - | 523475..524668 (+) | 1194 | WP_002990490.1 | pyridoxal phosphate-dependent aminotransferase | - |
| PVK50_RS02720 (PVK50_02685) | asnS | 524689..526035 (+) | 1347 | WP_002990488.1 | asparagine--tRNA ligase | - |
| PVK50_RS02725 (PVK50_02690) | rapZ | 526450..527340 (+) | 891 | WP_002990487.1 | RNase adapter RapZ | - |
| PVK50_RS02730 (PVK50_02695) | - | 527337..528314 (+) | 978 | WP_002985431.1 | YvcK family protein | - |
| PVK50_RS02735 (PVK50_02700) | whiA | 528311..529222 (+) | 912 | WP_002990485.1 | DNA-binding protein WhiA | - |
| PVK50_RS02740 (PVK50_02705) | - | 529399..530814 (-) | 1416 | WP_010922052.1 | recombinase family protein | - |
| PVK50_RS02745 (PVK50_02710) | - | 530938..531303 (-) | 366 | WP_010922053.1 | hypothetical protein | - |
| PVK50_RS02750 (PVK50_02715) | - | 531330..532091 (-) | 762 | WP_010922054.1 | helix-turn-helix transcriptional regulator | - |
| PVK50_RS02755 (PVK50_02720) | - | 532275..532505 (+) | 231 | WP_010922055.1 | helix-turn-helix domain-containing protein | - |
| PVK50_RS02760 (PVK50_02725) | - | 532574..532711 (+) | 138 | WP_010922056.1 | BOW99_gp33 family protein | - |
| PVK50_RS02765 (PVK50_02730) | - | 532713..532838 (+) | 126 | WP_010922057.1 | hypothetical protein | - |
| PVK50_RS02770 (PVK50_02735) | - | 532835..533062 (+) | 228 | WP_010922058.1 | hypothetical protein | - |
| PVK50_RS02775 (PVK50_02740) | - | 533062..534381 (+) | 1320 | WP_010922059.1 | AAA family ATPase | - |
| PVK50_RS02780 (PVK50_02745) | - | 534396..535487 (+) | 1092 | WP_010922060.1 | ATP-binding protein | - |
| PVK50_RS02785 (PVK50_02750) | - | 535527..535949 (+) | 423 | WP_010922061.1 | hypothetical protein | - |
| PVK50_RS02790 (PVK50_02755) | - | 535951..536685 (+) | 735 | WP_021775290.1 | hypothetical protein | - |
| PVK50_RS02795 (PVK50_02760) | - | 536707..537342 (+) | 636 | WP_010922063.1 | hypothetical protein | - |
| PVK50_RS02800 (PVK50_02765) | - | 537342..538925 (+) | 1584 | WP_010922064.1 | DEAD/DEAH box helicase | - |
| PVK50_RS02805 (PVK50_02770) | - | 538935..539564 (+) | 630 | WP_010922065.1 | hypothetical protein | - |
| PVK50_RS02810 (PVK50_02775) | - | 539554..541827 (+) | 2274 | WP_010922066.1 | AAA family ATPase | - |
| PVK50_RS02815 (PVK50_02780) | - | 542105..542323 (+) | 219 | WP_010922067.1 | crAss001_48 related protein | - |
| PVK50_RS02820 (PVK50_02785) | - | 542316..542711 (+) | 396 | WP_010922068.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PVK50_RS02825 (PVK50_02790) | - | 542708..542929 (+) | 222 | WP_010922069.1 | hypothetical protein | - |
| PVK50_RS02830 (PVK50_02795) | - | 542932..543204 (+) | 273 | WP_021775332.1 | hypothetical protein | - |
| PVK50_RS02835 (PVK50_02800) | - | 543207..543542 (+) | 336 | WP_011054813.1 | hypothetical protein | - |
| PVK50_RS02840 (PVK50_02805) | - | 543733..544134 (+) | 402 | WP_002987468.1 | hypothetical protein | - |
| PVK50_RS02845 (PVK50_02810) | - | 544134..544769 (+) | 636 | WP_021775330.1 | N-6 DNA methylase | - |
| PVK50_RS02850 (PVK50_02815) | - | 545034..545471 (+) | 438 | WP_003052405.1 | DUF1492 domain-containing protein | - |
| PVK50_RS02855 (PVK50_02820) | - | 545633..546799 (+) | 1167 | WP_019418850.1 | DNA modification methylase | - |
| PVK50_RS02860 (PVK50_02825) | - | 547142..547618 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| PVK50_RS02865 (PVK50_02830) | - | 547701..548912 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| PVK50_RS02870 (PVK50_02835) | - | 548926..550428 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| PVK50_RS02875 (PVK50_02840) | - | 550433..551926 (+) | 1494 | WP_397610649.1 | phage minor capsid protein | - |
| PVK50_RS02880 (PVK50_02845) | - | 551926..552153 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| PVK50_RS02885 (PVK50_02850) | - | 552240..552506 (+) | 267 | WP_010922078.1 | hypothetical protein | - |
| PVK50_RS02890 (PVK50_02855) | - | 552632..553246 (+) | 615 | WP_094751278.1 | hypothetical protein | - |
| PVK50_RS02895 (PVK50_02860) | - | 553250..554068 (+) | 819 | WP_397610650.1 | N4-gp56 family major capsid protein | - |
| PVK50_RS02900 (PVK50_02865) | - | 554122..554538 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| PVK50_RS02905 (PVK50_02870) | - | 554528..554860 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| PVK50_RS02910 (PVK50_02875) | - | 554860..555216 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| PVK50_RS02915 (PVK50_02880) | - | 555213..555612 (+) | 400 | Protein_525 | minor capsid protein | - |
| PVK50_RS02920 (PVK50_02885) | - | 555612..556097 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| PVK50_RS02925 (PVK50_02890) | - | 556136..556570 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| PVK50_RS02930 (PVK50_02895) | - | 556574..557155 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| PVK50_RS02935 (PVK50_02900) | - | 557145..560405 (+) | 3261 | WP_047235374.1 | tape measure protein | - |
| PVK50_RS02940 (PVK50_02905) | - | 560402..561118 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| PVK50_RS02945 (PVK50_02910) | - | 561115..563262 (+) | 2148 | WP_011284971.1 | phage tail spike protein | - |
| PVK50_RS02950 (PVK50_02915) | - | 563259..564473 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| PVK50_RS02955 (PVK50_02920) | - | 564475..564789 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| PVK50_RS02960 (PVK50_02925) | - | 564800..566689 (+) | 1890 | WP_115224503.1 | gp58-like family protein | - |
| PVK50_RS02965 (PVK50_02930) | - | 566701..567132 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| PVK50_RS02970 (PVK50_02935) | - | 567135..567755 (+) | 621 | WP_002988797.1 | hypothetical protein | - |
| PVK50_RS02975 (PVK50_02940) | - | 567766..568065 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| PVK50_RS02980 (PVK50_02945) | - | 568062..568247 (+) | 186 | WP_002988802.1 | holin | - |
| PVK50_RS02985 (PVK50_02950) | - | 568358..569554 (+) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| PVK50_RS02990 (PVK50_02955) | sda1 | 569670..570842 (-) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| PVK50_RS02995 (PVK50_02960) | prx | 571081..571260 (+) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| PVK50_RS03000 (PVK50_02965) | rimP | 571505..572041 (+) | 537 | WP_002988815.1 | ribosome maturation factor RimP | - |
| PVK50_RS03005 (PVK50_02970) | nusA | 572216..573373 (+) | 1158 | WP_002988817.1 | transcription termination factor NusA | - |
| PVK50_RS03010 (PVK50_02975) | rnpM | 573389..573685 (+) | 297 | WP_002983486.1 | RNase P modulator RnpM | - |
| PVK50_RS03015 (PVK50_02980) | - | 573678..573980 (+) | 303 | WP_002983488.1 | YlxQ-related RNA-binding protein | - |
| PVK50_RS03020 (PVK50_02985) | infB | 574000..576861 (+) | 2862 | WP_002983491.1 | translation initiation factor IF-2 | - |
| PVK50_RS03025 (PVK50_02990) | rbfA | 577067..577417 (+) | 351 | WP_002988820.1 | 30S ribosome-binding factor RbfA | - |
| PVK50_RS03030 (PVK50_02995) | - | 577548..578525 (-) | 978 | WP_223845213.1 | alpha/beta hydrolase fold domain-containing protein | - |
| PVK50_RS03035 (PVK50_03000) | - | 578709..579143 (+) | 435 | WP_002988824.1 | CopY/TcrY family copper transport repressor | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=791745 PVK50_RS02995 WP_002988813.1 571081..571260(+) (prx) [Streptococcus pyogenes strain 20164915]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=791745 PVK50_RS02995 WP_002988813.1 571081..571260(+) (prx) [Streptococcus pyogenes strain 20164915]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |