Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK51_RS06005 | Genome accession | NZ_CP118310 |
| Coordinates | 1133573..1133761 (+) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 20154051 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1095035..1135884 | 1133573..1133761 | within | 0 |
Gene organization within MGE regions
Location: 1095035..1135884
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK51_RS05700 (PVK51_05665) | - | 1095035..1095655 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| PVK51_RS05705 (PVK51_05670) | - | 1096018..1097106 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| PVK51_RS05710 (PVK51_05675) | - | 1097227..1098120 (-) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| PVK51_RS05715 (PVK51_05680) | - | 1098156..1098980 (-) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| PVK51_RS05720 (PVK51_05685) | - | 1099337..1099495 (+) | 159 | WP_011285583.1 | hypothetical protein | - |
| PVK51_RS05725 (PVK51_05690) | - | 1099525..1100124 (-) | 600 | WP_011284882.1 | hypothetical protein | - |
| PVK51_RS05730 (PVK51_05695) | - | 1100178..1100387 (+) | 210 | WP_011284881.1 | hypothetical protein | - |
| PVK51_RS05735 (PVK51_05700) | - | 1100376..1100762 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| PVK51_RS05740 (PVK51_05705) | - | 1100836..1101036 (+) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| PVK51_RS05745 (PVK51_05710) | - | 1101146..1101355 (-) | 210 | WP_011017885.1 | hypothetical protein | - |
| PVK51_RS05750 (PVK51_05715) | - | 1101486..1101854 (-) | 369 | WP_015055958.1 | hypothetical protein | - |
| PVK51_RS05755 (PVK51_05720) | - | 1101959..1102147 (+) | 189 | Protein_1079 | XRE family transcriptional regulator | - |
| PVK51_RS05760 (PVK51_05725) | - | 1102161..1102991 (+) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| PVK51_RS05765 (PVK51_05730) | - | 1102978..1103760 (+) | 783 | WP_011285581.1 | ATP-binding protein | - |
| PVK51_RS05770 (PVK51_05735) | - | 1103751..1103888 (+) | 138 | WP_011285580.1 | hypothetical protein | - |
| PVK51_RS05775 (PVK51_05740) | - | 1103901..1104254 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| PVK51_RS05780 (PVK51_05745) | - | 1104235..1104489 (+) | 255 | WP_011285578.1 | hypothetical protein | - |
| PVK51_RS05785 (PVK51_05750) | - | 1104511..1104993 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| PVK51_RS05790 (PVK51_05755) | - | 1104994..1105668 (+) | 675 | WP_011285576.1 | ERF family protein | - |
| PVK51_RS05795 (PVK51_05760) | ssb | 1105661..1106086 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| PVK51_RS05800 (PVK51_05765) | - | 1106092..1106295 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| PVK51_RS05805 (PVK51_05770) | - | 1106295..1106735 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PVK51_RS05810 (PVK51_05775) | - | 1106732..1107088 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| PVK51_RS05815 | - | 1107085..1107330 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| PVK51_RS05820 (PVK51_05780) | - | 1107330..1107566 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| PVK51_RS05825 (PVK51_05785) | - | 1107563..1107733 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| PVK51_RS05830 (PVK51_05790) | - | 1107730..1108014 (+) | 285 | WP_011018134.1 | hypothetical protein | - |
| PVK51_RS05835 (PVK51_05795) | - | 1108016..1108648 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| PVK51_RS05840 (PVK51_05800) | - | 1108651..1109175 (+) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| PVK51_RS05845 (PVK51_05805) | - | 1109172..1109438 (+) | 267 | WP_011018131.1 | hypothetical protein | - |
| PVK51_RS05850 (PVK51_05810) | - | 1109724..1110158 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PVK51_RS05855 (PVK51_05815) | - | 1110768..1111148 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| PVK51_RS05860 (PVK51_05820) | - | 1111138..1112412 (+) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| PVK51_RS05865 (PVK51_05825) | - | 1112412..1113737 (+) | 1326 | WP_011285570.1 | phage portal protein | - |
| PVK51_RS05870 (PVK51_05830) | - | 1113706..1114614 (+) | 909 | WP_011285569.1 | minor capsid protein | - |
| PVK51_RS05875 (PVK51_05835) | - | 1114621..1114890 (+) | 270 | WP_011285568.1 | hypothetical protein | - |
| PVK51_RS05880 (PVK51_05840) | - | 1114892..1115026 (+) | 135 | WP_015055956.1 | hypothetical protein | - |
| PVK51_RS05885 (PVK51_05845) | - | 1115135..1115704 (+) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| PVK51_RS05890 (PVK51_05850) | - | 1115723..1116613 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| PVK51_RS05895 (PVK51_05855) | - | 1116626..1116919 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| PVK51_RS05900 (PVK51_05860) | - | 1116933..1117277 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| PVK51_RS05905 (PVK51_05865) | - | 1117274..1117585 (+) | 312 | WP_011285567.1 | hypothetical protein | - |
| PVK51_RS05910 (PVK51_05870) | - | 1117582..1117977 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| PVK51_RS05915 (PVK51_05875) | - | 1117979..1118389 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| PVK51_RS05920 (PVK51_05880) | - | 1118401..1118907 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| PVK51_RS05925 (PVK51_05885) | - | 1118920..1119237 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| PVK51_RS05930 (PVK51_05890) | - | 1119210..1119668 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| PVK51_RS05935 (PVK51_05895) | - | 1119661..1121466 (+) | 1806 | WP_011054802.1 | tail protein | - |
| PVK51_RS05940 (PVK51_05900) | - | 1121467..1122951 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| PVK51_RS05945 (PVK51_05905) | - | 1122952..1126392 (+) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| PVK51_RS05950 (PVK51_05910) | - | 1126397..1128259 (+) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| PVK51_RS05955 (PVK51_05915) | - | 1128270..1128617 (+) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| PVK51_RS05960 (PVK51_05920) | - | 1128631..1128753 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| PVK51_RS05965 (PVK51_05925) | - | 1128767..1129090 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| PVK51_RS05970 (PVK51_05930) | - | 1129090..1129422 (+) | 333 | WP_011285562.1 | phage holin | - |
| PVK51_RS05975 (PVK51_05935) | - | 1129424..1130188 (+) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| PVK51_RS05980 (PVK51_05940) | - | 1130200..1130802 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| PVK51_RS05985 (PVK51_05945) | - | 1130813..1131586 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| PVK51_RS05990 (PVK51_05950) | - | 1131596..1131817 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| PVK51_RS05995 (PVK51_05955) | - | 1131817..1132476 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| PVK51_RS06000 (PVK51_05960) | speA | 1132598..1133353 (-) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| PVK51_RS06005 (PVK51_05965) | prx | 1133573..1133761 (+) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| PVK51_RS06015 (PVK51_05975) | - | 1134352..1134966 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| PVK51_RS06020 (PVK51_05980) | - | 1135099..1135884 (-) | 786 | WP_002989610.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=791703 PVK51_RS06005 WP_011285559.1 1133573..1133761(+) (prx) [Streptococcus pyogenes strain 20154051]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=791703 PVK51_RS06005 WP_011285559.1 1133573..1133761(+) (prx) [Streptococcus pyogenes strain 20154051]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |