Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK51_RS04180 | Genome accession | NZ_CP118310 |
| Coordinates | 771310..771489 (+) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 20154051 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 730873..779372 | 771310..771489 | within | 0 |
Gene organization within MGE regions
Location: 730873..779372
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK51_RS03915 (PVK51_03885) | - | 730873..731952 (-) | 1080 | WP_002988667.1 | site-specific integrase | - |
| PVK51_RS03920 (PVK51_03890) | - | 732069..732620 (-) | 552 | WP_002988670.1 | hypothetical protein | - |
| PVK51_RS03925 (PVK51_03895) | - | 732631..733014 (-) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PVK51_RS03930 (PVK51_03900) | - | 733028..733429 (-) | 402 | WP_011285676.1 | helix-turn-helix domain-containing protein | - |
| PVK51_RS03935 (PVK51_03905) | - | 733704..733859 (+) | 156 | WP_002988678.1 | hypothetical protein | - |
| PVK51_RS03940 (PVK51_03910) | - | 733840..734253 (-) | 414 | WP_002988681.1 | hypothetical protein | - |
| PVK51_RS03945 (PVK51_03915) | - | 734301..734516 (+) | 216 | WP_002988684.1 | hypothetical protein | - |
| PVK51_RS03950 (PVK51_03920) | - | 734578..734853 (+) | 276 | WP_002988687.1 | hypothetical protein | - |
| PVK51_RS03955 (PVK51_03925) | - | 734850..735020 (+) | 171 | WP_002988693.1 | hypothetical protein | - |
| PVK51_RS03960 (PVK51_03930) | - | 735013..735216 (+) | 204 | WP_002988697.1 | hypothetical protein | - |
| PVK51_RS03965 (PVK51_03935) | - | 735213..735599 (+) | 387 | WP_002988700.1 | hypothetical protein | - |
| PVK51_RS03970 (PVK51_03940) | - | 735596..735748 (+) | 153 | WP_011285675.1 | hypothetical protein | - |
| PVK51_RS03975 (PVK51_03945) | - | 735745..735948 (+) | 204 | WP_002988705.1 | hypothetical protein | - |
| PVK51_RS03980 (PVK51_03950) | - | 736036..736335 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| PVK51_RS03985 (PVK51_03955) | - | 736335..737489 (+) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| PVK51_RS03990 (PVK51_03960) | - | 737493..737891 (+) | 399 | WP_002988715.1 | hypothetical protein | - |
| PVK51_RS03995 (PVK51_03965) | - | 737902..738459 (+) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| PVK51_RS04000 (PVK51_03970) | - | 738502..740424 (+) | 1923 | WP_002988723.1 | DNA polymerase | - |
| PVK51_RS04005 (PVK51_03975) | - | 740429..742813 (+) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| PVK51_RS04010 (PVK51_03980) | - | 743200..743475 (+) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| PVK51_RS04015 (PVK51_03985) | - | 743472..744794 (+) | 1323 | WP_397610630.1 | SNF2-related protein | - |
| PVK51_RS04020 (PVK51_03990) | - | 744795..744962 (+) | 168 | WP_002988735.1 | hypothetical protein | - |
| PVK51_RS04025 (PVK51_03995) | - | 744959..745225 (+) | 267 | WP_002988738.1 | hypothetical protein | - |
| PVK51_RS04030 (PVK51_04000) | - | 745234..746085 (+) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| PVK51_RS04035 (PVK51_04005) | - | 746075..746266 (+) | 192 | WP_002988743.1 | hypothetical protein | - |
| PVK51_RS04040 (PVK51_04010) | - | 746263..746679 (+) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| PVK51_RS04045 (PVK51_04015) | - | 746769..747221 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| PVK51_RS04050 (PVK51_04020) | - | 747211..748488 (+) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| PVK51_RS04055 (PVK51_04025) | - | 748504..750036 (+) | 1533 | WP_002988758.1 | phage portal protein | - |
| PVK51_RS04060 (PVK51_04030) | - | 749996..751441 (+) | 1446 | WP_015446273.1 | minor capsid protein | - |
| PVK51_RS04065 (PVK51_04035) | - | 751472..751660 (+) | 189 | WP_002983423.1 | hypothetical protein | - |
| PVK51_RS04070 (PVK51_04040) | - | 751663..751929 (+) | 267 | WP_002988765.1 | hypothetical protein | - |
| PVK51_RS04075 (PVK51_04045) | - | 752085..752654 (+) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| PVK51_RS04080 (PVK51_04050) | - | 752667..753554 (+) | 888 | WP_002988771.1 | hypothetical protein | - |
| PVK51_RS04085 (PVK51_04055) | - | 753566..753922 (+) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| PVK51_RS04090 (PVK51_04060) | - | 753933..754211 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| PVK51_RS04095 (PVK51_04065) | - | 754208..754552 (+) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PVK51_RS04100 (PVK51_04070) | - | 754556..754915 (+) | 360 | WP_002988782.1 | hypothetical protein | - |
| PVK51_RS04105 (PVK51_04075) | - | 754927..755526 (+) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| PVK51_RS04110 (PVK51_04080) | - | 755580..756035 (+) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| PVK51_RS04115 (PVK51_04085) | - | 756110..756343 (+) | 234 | WP_002983445.1 | hypothetical protein | - |
| PVK51_RS04120 (PVK51_04090) | - | 756358..760740 (+) | 4383 | WP_002988786.1 | tape measure protein | - |
| PVK51_RS04125 (PVK51_04095) | - | 760752..761594 (+) | 843 | WP_002988788.1 | phage tail family protein | - |
| PVK51_RS04130 (PVK51_04100) | - | 761604..763586 (+) | 1983 | WP_002988790.1 | phage tail protein | - |
| PVK51_RS04135 (PVK51_04105) | - | 763583..764638 (+) | 1056 | WP_002988439.1 | hypothetical protein | - |
| PVK51_RS04140 (PVK51_04110) | - | 764638..765273 (+) | 636 | WP_002988442.1 | hypothetical protein | - |
| PVK51_RS04145 (PVK51_04115) | - | 765284..767191 (+) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| PVK51_RS04150 (PVK51_04120) | - | 767200..767361 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| PVK51_RS04155 (PVK51_04125) | - | 767364..767984 (+) | 621 | WP_002988797.1 | hypothetical protein | - |
| PVK51_RS04160 (PVK51_04130) | - | 767995..768294 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| PVK51_RS04165 (PVK51_04135) | - | 768291..768476 (+) | 186 | WP_002988802.1 | holin | - |
| PVK51_RS04170 (PVK51_04140) | - | 768587..769783 (+) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| PVK51_RS04175 (PVK51_04145) | sda1 | 769899..771071 (-) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| PVK51_RS04180 (PVK51_04150) | prx | 771310..771489 (+) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| PVK51_RS04185 (PVK51_04155) | rimP | 771734..772270 (+) | 537 | WP_002988815.1 | ribosome maturation factor RimP | - |
| PVK51_RS04190 (PVK51_04160) | nusA | 772445..773602 (+) | 1158 | WP_002988817.1 | transcription termination factor NusA | - |
| PVK51_RS04195 (PVK51_04165) | rnpM | 773618..773914 (+) | 297 | WP_002983486.1 | RNase P modulator RnpM | - |
| PVK51_RS04200 (PVK51_04170) | - | 773907..774209 (+) | 303 | WP_002983488.1 | YlxQ-related RNA-binding protein | - |
| PVK51_RS04205 (PVK51_04175) | infB | 774229..777090 (+) | 2862 | WP_002983491.1 | translation initiation factor IF-2 | - |
| PVK51_RS04210 (PVK51_04180) | rbfA | 777296..777646 (+) | 351 | WP_002988820.1 | 30S ribosome-binding factor RbfA | - |
| PVK51_RS04215 (PVK51_04185) | - | 777777..778754 (-) | 978 | WP_223845213.1 | alpha/beta hydrolase fold domain-containing protein | - |
| PVK51_RS04220 (PVK51_04190) | - | 778938..779372 (+) | 435 | WP_002988824.1 | CopY/TcrY family copper transport repressor | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=791693 PVK51_RS04180 WP_002988813.1 771310..771489(+) (prx) [Streptococcus pyogenes strain 20154051]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=791693 PVK51_RS04180 WP_002988813.1 771310..771489(+) (prx) [Streptococcus pyogenes strain 20154051]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |