Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK55_RS03010 | Genome accession | NZ_CP118309 |
| Coordinates | 573597..573779 (+) | Length | 60 a.a. |
| NCBI ID | WP_002986897.1 | Uniprot ID | A0A660A6E2 |
| Organism | Streptococcus pyogenes strain 20192362 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 516049..573779 | 573597..573779 | within | 0 |
Gene organization within MGE regions
Location: 516049..573779
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK55_RS02690 (PVK55_02655) | ftsE | 517048..517740 (+) | 693 | WP_002985455.1 | cell division ATP-binding protein FtsE | - |
| PVK55_RS02695 (PVK55_02660) | ftsX | 517733..518662 (+) | 930 | WP_002990498.1 | permease-like cell division protein FtsX | - |
| PVK55_RS02700 (PVK55_02665) | - | 518971..519606 (-) | 636 | WP_002990496.1 | MBL fold metallo-hydrolase | - |
| PVK55_RS02705 (PVK55_02670) | - | 519837..520601 (+) | 765 | WP_002990495.1 | (S)-acetoin forming diacetyl reductase | - |
| PVK55_RS02710 (PVK55_02675) | - | 520751..523210 (+) | 2460 | WP_032461507.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
| PVK55_RS02715 (PVK55_02680) | - | 523545..524738 (+) | 1194 | WP_002990490.1 | pyridoxal phosphate-dependent aminotransferase | - |
| PVK55_RS02720 (PVK55_02685) | asnS | 524759..526105 (+) | 1347 | WP_002990488.1 | asparagine--tRNA ligase | - |
| PVK55_RS02725 (PVK55_02690) | rapZ | 526520..527410 (+) | 891 | WP_002990487.1 | RNase adapter RapZ | - |
| PVK55_RS02730 (PVK55_02695) | - | 527407..528384 (+) | 978 | WP_002985431.1 | YvcK family protein | - |
| PVK55_RS02735 (PVK55_02700) | whiA | 528381..529292 (+) | 912 | WP_002990485.1 | DNA-binding protein WhiA | - |
| PVK55_RS02740 (PVK55_02705) | - | 529469..530884 (-) | 1416 | WP_010922052.1 | recombinase family protein | - |
| PVK55_RS02745 (PVK55_02710) | - | 531008..531373 (-) | 366 | WP_010922053.1 | hypothetical protein | - |
| PVK55_RS02750 (PVK55_02715) | - | 531400..532161 (-) | 762 | WP_010922054.1 | helix-turn-helix transcriptional regulator | - |
| PVK55_RS02755 (PVK55_02720) | - | 532345..532575 (+) | 231 | WP_010922055.1 | helix-turn-helix domain-containing protein | - |
| PVK55_RS02760 (PVK55_02725) | - | 532644..532781 (+) | 138 | WP_010922056.1 | BOW99_gp33 family protein | - |
| PVK55_RS02765 (PVK55_02730) | - | 532783..532908 (+) | 126 | WP_010922057.1 | hypothetical protein | - |
| PVK55_RS02770 (PVK55_02735) | - | 532905..533132 (+) | 228 | WP_010922058.1 | hypothetical protein | - |
| PVK55_RS02775 (PVK55_02740) | - | 533132..534451 (+) | 1320 | WP_010922059.1 | AAA family ATPase | - |
| PVK55_RS02780 (PVK55_02745) | - | 534466..535557 (+) | 1092 | WP_010922060.1 | ATP-binding protein | - |
| PVK55_RS02785 (PVK55_02750) | - | 535597..536019 (+) | 423 | WP_010922061.1 | hypothetical protein | - |
| PVK55_RS02790 (PVK55_02755) | - | 536021..536755 (+) | 735 | WP_021775290.1 | hypothetical protein | - |
| PVK55_RS02795 (PVK55_02760) | - | 536777..537412 (+) | 636 | WP_010922063.1 | hypothetical protein | - |
| PVK55_RS02800 (PVK55_02765) | - | 537412..538995 (+) | 1584 | WP_010922064.1 | DEAD/DEAH box helicase | - |
| PVK55_RS02805 (PVK55_02770) | - | 539005..539634 (+) | 630 | WP_010922065.1 | hypothetical protein | - |
| PVK55_RS02810 (PVK55_02775) | - | 539624..541897 (+) | 2274 | WP_010922066.1 | AAA family ATPase | - |
| PVK55_RS02815 (PVK55_02780) | - | 542175..542393 (+) | 219 | WP_010922067.1 | crAss001_48 related protein | - |
| PVK55_RS02820 (PVK55_02785) | - | 542386..542781 (+) | 396 | WP_010922068.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PVK55_RS02825 (PVK55_02790) | - | 542778..542999 (+) | 222 | WP_010922069.1 | hypothetical protein | - |
| PVK55_RS02830 (PVK55_02795) | - | 543002..543274 (+) | 273 | WP_021775332.1 | hypothetical protein | - |
| PVK55_RS02835 (PVK55_02800) | - | 543277..543612 (+) | 336 | WP_011054813.1 | hypothetical protein | - |
| PVK55_RS02840 (PVK55_02805) | - | 543803..544204 (+) | 402 | WP_002987468.1 | hypothetical protein | - |
| PVK55_RS02845 (PVK55_02810) | - | 544204..544839 (+) | 636 | WP_021775330.1 | N-6 DNA methylase | - |
| PVK55_RS02850 (PVK55_02815) | - | 545104..545541 (+) | 438 | WP_003052405.1 | DUF1492 domain-containing protein | - |
| PVK55_RS02855 (PVK55_02820) | - | 545703..546869 (+) | 1167 | WP_019418850.1 | DNA modification methylase | - |
| PVK55_RS02860 (PVK55_02825) | - | 547212..547688 (+) | 477 | WP_397610684.1 | hypothetical protein | - |
| PVK55_RS02865 (PVK55_02830) | - | 547771..548982 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| PVK55_RS02870 (PVK55_02835) | - | 548996..550498 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| PVK55_RS02875 (PVK55_02840) | - | 550503..551981 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| PVK55_RS02880 (PVK55_02845) | - | 551953..552192 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| PVK55_RS02885 (PVK55_02850) | - | 552254..552520 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| PVK55_RS02890 (PVK55_02855) | - | 552646..553260 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| PVK55_RS02895 (PVK55_02860) | - | 553264..554082 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| PVK55_RS02900 (PVK55_02865) | - | 554136..554552 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| PVK55_RS02905 (PVK55_02870) | - | 554542..554874 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| PVK55_RS02910 (PVK55_02875) | - | 554874..555230 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| PVK55_RS02915 (PVK55_02880) | - | 555227..555625 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| PVK55_RS02920 (PVK55_02885) | - | 555625..556110 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| PVK55_RS02925 (PVK55_02890) | - | 556149..556583 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| PVK55_RS02930 (PVK55_02895) | - | 556587..557168 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| PVK55_RS02935 (PVK55_02900) | - | 557158..560418 (+) | 3261 | WP_047235374.1 | tape measure protein | - |
| PVK55_RS02940 (PVK55_02905) | - | 560415..561131 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| PVK55_RS02945 (PVK55_02910) | - | 561128..563275 (+) | 2148 | WP_397610683.1 | phage tail spike protein | - |
| PVK55_RS02950 (PVK55_02915) | - | 563272..564495 (+) | 1224 | WP_030127718.1 | hypothetical protein | - |
| PVK55_RS02955 (PVK55_02920) | - | 564497..564811 (+) | 315 | WP_063812987.1 | hypothetical protein | - |
| PVK55_RS02960 (PVK55_02925) | - | 564822..566708 (+) | 1887 | WP_136075572.1 | gp58-like family protein | - |
| PVK55_RS02965 (PVK55_02930) | - | 566720..567151 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| PVK55_RS02970 (PVK55_02935) | - | 567154..567771 (+) | 618 | WP_032461328.1 | DUF1366 domain-containing protein | - |
| PVK55_RS02975 (PVK55_02940) | - | 567781..568056 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| PVK55_RS02980 (PVK55_02945) | - | 568053..568280 (+) | 228 | WP_000609113.1 | phage holin | - |
| PVK55_RS02985 (PVK55_02950) | - | 568396..569598 (+) | 1203 | WP_023611747.1 | glucosaminidase domain-containing protein | - |
| PVK55_RS02990 (PVK55_02955) | - | 569738..570262 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| PVK55_RS02995 (PVK55_02960) | - | 570250..571116 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| PVK55_RS03000 (PVK55_02965) | spek | 571421..572200 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| PVK55_RS03005 (PVK55_02970) | - | 572676..573251 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| PVK55_RS03010 (PVK55_02980) | prx | 573597..573779 (+) | 183 | WP_002986897.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6772.68 Da Isoelectric Point: 3.9286
>NTDB_id=791634 PVK55_RS03010 WP_002986897.1 573597..573779(+) (prx) [Streptococcus pyogenes strain 20192362]
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDDGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=791634 PVK55_RS03010 WP_002986897.1 573597..573779(+) (prx) [Streptococcus pyogenes strain 20192362]
ATGCTAACATACGACGAGTTTAAGCAAGCAATCGATGACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCAATCGATGACGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS8232 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |