Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK53_RS07250 | Genome accession | NZ_CP118308 |
| Coordinates | 1420994..1421173 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 20203206 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1420994..1461610 | 1420994..1421173 | within | 0 |
Gene organization within MGE regions
Location: 1420994..1461610
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK53_RS07250 (PVK53_07205) | prx | 1420994..1421173 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| PVK53_RS07255 (PVK53_07210) | sda1 | 1421412..1422584 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| PVK53_RS07260 (PVK53_07215) | - | 1422700..1423896 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| PVK53_RS07265 (PVK53_07220) | - | 1424007..1424192 (-) | 186 | WP_002988802.1 | holin | - |
| PVK53_RS07270 (PVK53_07225) | - | 1424189..1424488 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| PVK53_RS07275 (PVK53_07230) | - | 1424499..1425119 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| PVK53_RS07280 (PVK53_07235) | - | 1425122..1425283 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| PVK53_RS07285 (PVK53_07240) | - | 1425292..1427199 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| PVK53_RS07290 (PVK53_07245) | - | 1427210..1427845 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| PVK53_RS07295 (PVK53_07250) | - | 1427845..1428900 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| PVK53_RS07300 (PVK53_07255) | - | 1428897..1430879 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| PVK53_RS07305 (PVK53_07260) | - | 1430889..1431731 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| PVK53_RS07310 (PVK53_07265) | - | 1431743..1436125 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| PVK53_RS07315 (PVK53_07270) | - | 1436140..1436373 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| PVK53_RS07320 (PVK53_07275) | - | 1436448..1436903 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| PVK53_RS07325 (PVK53_07280) | - | 1436957..1437556 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| PVK53_RS07330 (PVK53_07285) | - | 1437568..1437927 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| PVK53_RS07335 (PVK53_07290) | - | 1437931..1438275 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PVK53_RS07340 (PVK53_07295) | - | 1438272..1438550 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| PVK53_RS07345 (PVK53_07300) | - | 1438561..1438917 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| PVK53_RS07350 (PVK53_07305) | - | 1438929..1439816 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| PVK53_RS07355 (PVK53_07310) | - | 1439829..1440398 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| PVK53_RS07360 (PVK53_07315) | - | 1440554..1440820 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| PVK53_RS07365 (PVK53_07320) | - | 1440823..1441011 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| PVK53_RS07370 (PVK53_07325) | - | 1441042..1442487 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| PVK53_RS07375 (PVK53_07330) | - | 1442447..1443979 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| PVK53_RS07380 (PVK53_07335) | - | 1443995..1445272 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| PVK53_RS07385 (PVK53_07340) | - | 1445262..1445714 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| PVK53_RS07390 (PVK53_07345) | - | 1445804..1446220 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| PVK53_RS07395 (PVK53_07350) | - | 1446217..1446408 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| PVK53_RS07400 (PVK53_07355) | - | 1446398..1447249 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| PVK53_RS07405 (PVK53_07360) | - | 1447258..1447524 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| PVK53_RS07410 (PVK53_07365) | - | 1447521..1447688 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| PVK53_RS07415 (PVK53_07370) | - | 1447689..1449011 (-) | 1323 | WP_397610630.1 | SNF2-related protein | - |
| PVK53_RS07420 (PVK53_07375) | - | 1449008..1449283 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| PVK53_RS07425 (PVK53_07380) | - | 1449670..1452054 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| PVK53_RS07430 (PVK53_07385) | - | 1452059..1453981 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| PVK53_RS07435 (PVK53_07390) | - | 1454024..1454581 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| PVK53_RS07440 (PVK53_07395) | - | 1454592..1454990 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| PVK53_RS07445 (PVK53_07400) | - | 1454994..1456148 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| PVK53_RS07450 (PVK53_07405) | - | 1456148..1456447 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| PVK53_RS07455 (PVK53_07410) | - | 1456535..1456738 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| PVK53_RS07460 (PVK53_07415) | - | 1456884..1457270 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| PVK53_RS07465 (PVK53_07420) | - | 1457267..1457470 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| PVK53_RS07470 (PVK53_07425) | - | 1457463..1457633 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| PVK53_RS07475 (PVK53_07430) | - | 1457630..1457905 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| PVK53_RS07480 (PVK53_07435) | - | 1457967..1458182 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| PVK53_RS07485 (PVK53_07440) | - | 1458230..1458643 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| PVK53_RS07490 (PVK53_07445) | - | 1458624..1458779 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| PVK53_RS07495 (PVK53_07450) | - | 1459054..1459455 (+) | 402 | WP_011285676.1 | helix-turn-helix domain-containing protein | - |
| PVK53_RS07500 (PVK53_07455) | - | 1459469..1459852 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PVK53_RS07505 (PVK53_07460) | - | 1459863..1460414 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| PVK53_RS07510 (PVK53_07465) | - | 1460531..1461610 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=791595 PVK53_RS07250 WP_002988813.1 1420994..1421173(-) (prx) [Streptococcus pyogenes strain 20203206]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=791595 PVK53_RS07250 WP_002988813.1 1420994..1421173(-) (prx) [Streptococcus pyogenes strain 20203206]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |