Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK48_RS07255 | Genome accession | NZ_CP118307 |
| Coordinates | 1421045..1421224 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain 20200554 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1421045..1461661 | 1421045..1421224 | within | 0 |
Gene organization within MGE regions
Location: 1421045..1461661
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK48_RS07255 (PVK48_07200) | prx | 1421045..1421224 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| PVK48_RS07260 (PVK48_07205) | sda1 | 1421463..1422635 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| PVK48_RS07265 (PVK48_07210) | - | 1422751..1423947 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| PVK48_RS07270 (PVK48_07215) | - | 1424058..1424243 (-) | 186 | WP_002988802.1 | holin | - |
| PVK48_RS07275 (PVK48_07220) | - | 1424240..1424539 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| PVK48_RS07280 (PVK48_07225) | - | 1424550..1425170 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| PVK48_RS07285 (PVK48_07230) | - | 1425173..1425334 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| PVK48_RS07290 (PVK48_07235) | - | 1425343..1427250 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| PVK48_RS07295 (PVK48_07240) | - | 1427261..1427896 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| PVK48_RS07300 (PVK48_07245) | - | 1427896..1428951 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| PVK48_RS07305 (PVK48_07250) | - | 1428948..1430930 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| PVK48_RS07310 (PVK48_07255) | - | 1430940..1431782 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| PVK48_RS07315 (PVK48_07260) | - | 1431794..1436176 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| PVK48_RS07320 (PVK48_07265) | - | 1436191..1436424 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| PVK48_RS07325 (PVK48_07270) | - | 1436499..1436954 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| PVK48_RS07330 (PVK48_07275) | - | 1437008..1437607 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| PVK48_RS07335 (PVK48_07280) | - | 1437619..1437978 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| PVK48_RS07340 (PVK48_07285) | - | 1437982..1438326 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PVK48_RS07345 (PVK48_07290) | - | 1438323..1438601 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| PVK48_RS07350 (PVK48_07295) | - | 1438612..1438968 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| PVK48_RS07355 (PVK48_07300) | - | 1438980..1439867 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| PVK48_RS07360 (PVK48_07305) | - | 1439880..1440449 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| PVK48_RS07365 (PVK48_07310) | - | 1440605..1440871 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| PVK48_RS07370 (PVK48_07315) | - | 1440874..1441062 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| PVK48_RS07375 (PVK48_07320) | - | 1441093..1442538 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| PVK48_RS07380 (PVK48_07325) | - | 1442498..1444030 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| PVK48_RS07385 (PVK48_07330) | - | 1444046..1445323 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| PVK48_RS07390 (PVK48_07335) | - | 1445313..1445765 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| PVK48_RS07395 (PVK48_07340) | - | 1445855..1446271 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| PVK48_RS07400 (PVK48_07345) | - | 1446268..1446459 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| PVK48_RS07405 (PVK48_07350) | - | 1446449..1447300 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| PVK48_RS07410 (PVK48_07355) | - | 1447309..1447575 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| PVK48_RS07415 (PVK48_07360) | - | 1447572..1447739 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| PVK48_RS07420 (PVK48_07365) | - | 1447740..1449062 (-) | 1323 | WP_397610630.1 | SNF2-related protein | - |
| PVK48_RS07425 (PVK48_07370) | - | 1449059..1449334 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| PVK48_RS07430 (PVK48_07375) | - | 1449721..1452105 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| PVK48_RS07435 (PVK48_07380) | - | 1452110..1454032 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| PVK48_RS07440 (PVK48_07385) | - | 1454075..1454632 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| PVK48_RS07445 (PVK48_07390) | - | 1454643..1455041 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| PVK48_RS07450 (PVK48_07395) | - | 1455045..1456199 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| PVK48_RS07455 (PVK48_07400) | - | 1456199..1456498 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| PVK48_RS07460 (PVK48_07405) | - | 1456586..1456789 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| PVK48_RS07465 (PVK48_07410) | - | 1456786..1456938 (-) | 153 | WP_011285675.1 | hypothetical protein | - |
| PVK48_RS07470 (PVK48_07415) | - | 1456935..1457321 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| PVK48_RS07475 (PVK48_07420) | - | 1457318..1457521 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| PVK48_RS07480 (PVK48_07425) | - | 1457514..1457684 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| PVK48_RS07485 (PVK48_07430) | - | 1457681..1457956 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| PVK48_RS07490 (PVK48_07435) | - | 1458018..1458233 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| PVK48_RS07495 (PVK48_07440) | - | 1458281..1458694 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| PVK48_RS07500 (PVK48_07445) | - | 1458675..1458830 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| PVK48_RS07505 (PVK48_07450) | - | 1459105..1459506 (+) | 402 | WP_011285676.1 | helix-turn-helix domain-containing protein | - |
| PVK48_RS07510 (PVK48_07455) | - | 1459520..1459903 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PVK48_RS07515 (PVK48_07460) | - | 1459914..1460465 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| PVK48_RS07520 (PVK48_07465) | - | 1460582..1461661 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=791540 PVK48_RS07255 WP_002988813.1 1421045..1421224(-) (prx) [Streptococcus pyogenes strain 20200554]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=791540 PVK48_RS07255 WP_002988813.1 1421045..1421224(-) (prx) [Streptococcus pyogenes strain 20200554]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |