Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | PVK49_RS03470 | Genome accession | NZ_CP118306 |
| Coordinates | 668553..668735 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 20154608 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 633931..668735 | 668553..668735 | within | 0 |
Gene organization within MGE regions
Location: 633931..668735
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK49_RS03200 (PVK49_03195) | - | 633931..634206 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| PVK49_RS03205 (PVK49_03200) | - | 634295..635437 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| PVK49_RS03210 (PVK49_03205) | - | 635561..636079 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| PVK49_RS03215 (PVK49_03210) | - | 636091..636846 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| PVK49_RS03220 (PVK49_03215) | - | 637048..637260 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| PVK49_RS03225 (PVK49_03220) | - | 637530..637841 (+) | 312 | WP_010922478.1 | excisionase | - |
| PVK49_RS03230 (PVK49_03225) | - | 637843..638028 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| PVK49_RS03235 (PVK49_03230) | - | 638122..638391 (+) | 270 | WP_011106700.1 | replication protein | - |
| PVK49_RS03240 (PVK49_03235) | - | 638532..638918 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| PVK49_RS03245 (PVK49_03240) | - | 638899..639132 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| PVK49_RS03250 (PVK49_03245) | - | 639129..639269 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| PVK49_RS03255 (PVK49_03250) | - | 639278..639484 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| PVK49_RS03260 (PVK49_03255) | - | 639540..639870 (+) | 331 | Protein_579 | hypothetical protein | - |
| PVK49_RS03265 (PVK49_03260) | - | 639873..640799 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| PVK49_RS03270 (PVK49_03265) | - | 640796..640996 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| PVK49_RS03275 (PVK49_03270) | - | 640989..641786 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| PVK49_RS03280 (PVK49_03275) | - | 642151..642546 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| PVK49_RS03285 (PVK49_03280) | - | 642543..643889 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| PVK49_RS03290 (PVK49_03285) | - | 643900..644232 (+) | 333 | WP_011184741.1 | hypothetical protein | - |
| PVK49_RS03295 (PVK49_03290) | - | 644229..644741 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| PVK49_RS03300 (PVK49_03295) | - | 644777..645094 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| PVK49_RS03305 (PVK49_03300) | - | 645091..645246 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| PVK49_RS03310 (PVK49_03305) | - | 645243..645494 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| PVK49_RS03315 (PVK49_03310) | - | 645570..645989 (+) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| PVK49_RS03320 (PVK49_03315) | - | 646097..646441 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| PVK49_RS03325 (PVK49_03320) | - | 646589..646945 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| PVK49_RS03330 (PVK49_03325) | - | 646942..648210 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| PVK49_RS03335 (PVK49_03330) | - | 648203..649696 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| PVK49_RS03340 (PVK49_03335) | - | 649702..649926 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| PVK49_RS03345 (PVK49_03340) | - | 650003..650155 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| PVK49_RS03350 (PVK49_03345) | - | 650148..650414 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| PVK49_RS03355 (PVK49_03350) | - | 650416..650631 (+) | 216 | WP_011106704.1 | hypothetical protein | - |
| PVK49_RS03360 (PVK49_03355) | - | 650713..652128 (+) | 1416 | WP_011054685.1 | terminase | - |
| PVK49_RS03365 (PVK49_03360) | - | 652209..652670 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| PVK49_RS03370 (PVK49_03365) | - | 652695..653606 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| PVK49_RS03375 (PVK49_03370) | - | 653606..653806 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| PVK49_RS03380 (PVK49_03375) | - | 653816..654238 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| PVK49_RS03385 (PVK49_03380) | - | 654198..654536 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| PVK49_RS03390 (PVK49_03385) | - | 654529..654765 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| PVK49_RS03395 (PVK49_03390) | - | 654766..655101 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| PVK49_RS03400 (PVK49_03395) | - | 655117..655707 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| PVK49_RS03405 (PVK49_03400) | - | 655718..655981 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| PVK49_RS03410 (PVK49_03405) | - | 655996..656367 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| PVK49_RS03415 (PVK49_03410) | - | 656367..658730 (+) | 2364 | WP_030126402.1 | hypothetical protein | - |
| PVK49_RS03420 (PVK49_03415) | - | 658727..659422 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| PVK49_RS03425 (PVK49_03420) | - | 659404..661377 (+) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| PVK49_RS03430 (PVK49_03425) | - | 661377..662486 (+) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| PVK49_RS03435 (PVK49_03430) | - | 662501..664282 (+) | 1782 | WP_011184733.1 | gp58-like family protein | - |
| PVK49_RS03440 (PVK49_03435) | - | 664291..664719 (+) | 429 | WP_011184732.1 | DUF1617 family protein | - |
| PVK49_RS03445 (PVK49_03440) | - | 664722..665333 (+) | 612 | WP_011184731.1 | DUF1366 domain-containing protein | - |
| PVK49_RS03450 (PVK49_03445) | - | 665343..665798 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| PVK49_RS03455 (PVK49_03450) | - | 665916..666668 (+) | 753 | WP_030126404.1 | CHAP domain-containing protein | - |
| PVK49_RS03460 (PVK49_03455) | speC | 666737..667444 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| PVK49_RS03465 (PVK49_03460) | mf2 | 667555..668313 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| PVK49_RS03470 (PVK49_03465) | prx | 668553..668735 (+) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=791472 PVK49_RS03470 WP_011184726.1 668553..668735(+) (prx) [Streptococcus pyogenes strain 20154608]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=791472 PVK49_RS03470 WP_011184726.1 668553..668735(+) (prx) [Streptococcus pyogenes strain 20154608]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |