NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	PUW70_RS02620	Genome accession	NZ_CP118029
Coordinates	506741..507355 (+)	Length	204 a.a.
NCBI ID	WP_224783675.1	Uniprot ID	-
Organism	Streptococcus anginosus strain VSI68
Function	degradation of ComX; require for competence development (at the early growth phase); repress competence development (at the mid-logarithmic growth phase) (predicted from homology) Competence regulation

Genomic Context

Location: 501741..512355

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PUW70_RS02610 (PUW70_02610)	mgtA	503270..505925 (+)	2656	Protein_473	magnesium-translocating P-type ATPase	-
PUW70_RS02615 (PUW70_02615)	upp	506023..506652 (+)	630	WP_003025639.1	uracil phosphoribosyltransferase	-
PUW70_RS02620 (PUW70_02620)	clpP	506741..507355 (+)	615	WP_224783675.1	ATP-dependent Clp protease proteolytic subunit	Regulator
PUW70_RS02625 (PUW70_02625)	-	507448..507717 (+)	270	WP_042754006.1	DUF2129 domain-containing protein	-
PUW70_RS02630 (PUW70_02630)	-	507800..508963 (+)	1164	WP_024052039.1	ABC transporter substrate-binding protein	-
PUW70_RS02635 (PUW70_02635)	-	509354..510223 (+)	870	WP_024052038.1	branched-chain amino acid ABC transporter permease	-
PUW70_RS02640 (PUW70_02640)	-	510227..511177 (+)	951	WP_024052037.1	branched-chain amino acid ABC transporter permease	-
PUW70_RS02645 (PUW70_02645)	-	511177..511941 (+)	765	WP_003032371.1	ABC transporter ATP-binding protein	-

Sequence

Protein

Download Length: 204 a.a. Molecular weight: 22464.62 Da Isoelectric Point: 4.7348

                                >NTDB_id=789237 PUW70_RS02620 WP_224783675.1 506741..507355(+) (clpP) [Streptococcus anginosus strain VSI68]

MSDEKENTMIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGAVEDNMANSIIAQLLFLDAQDSTKDIYLYINTPGGSVSAG

LAIVDTMNFIKSDVQTIVMGMAASMGTIIASSGAKGKRFMLPNAEYLIHQPMGGTGSGTQQTDMAIAAEHLLKTRNNLEK

ILADNSGKTIKQVHKDAERDYWMSAQETLDYGFIDEIMANNKLN

Nucleotide

Download Length: 615 bp

                                >NTDB_id=789237 PUW70_RS02620 WP_224783675.1 506741..507355(+) (clpP) [Streptococcus anginosus strain VSI68]

ATATCAGATGAAAAGGAGAATACAATGATTCCTGTAGTTATTGAACAAACAAGCCGTGGAGAACGTTCCTACGATATTTA

CTCGCGTCTTTTAAAAGATCGCATTATTATGCTAACTGGAGCAGTTGAAGACAACATGGCCAATTCTATTATTGCCCAAC

TGCTTTTCCTAGATGCTCAAGATAGTACAAAGGATATTTATCTTTATATCAATACACCAGGAGGTTCTGTATCGGCTGGT

CTAGCGATTGTTGATACCATGAACTTCATCAAGTCAGATGTCCAAACAATTGTCATGGGGATGGCTGCTTCCATGGGAAC

TATTATCGCTTCAAGCGGTGCTAAAGGCAAACGCTTCATGTTGCCGAATGCAGAATACTTGATTCACCAACCAATGGGCG

GAACTGGTAGCGGTACGCAACAAACCGATATGGCGATTGCAGCTGAGCATTTGCTGAAAACTCGGAATAACTTGGAGAAA

ATCCTTGCGGATAATTCAGGGAAAACCATTAAGCAAGTACATAAAGACGCAGAACGCGATTATTGGATGAGCGCTCAAGA

AACCTTGGATTATGGTTTCATTGATGAAATTATGGCAAATAATAAATTAAACTAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(19-200)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Streptococcus mutans UA159	88.67	99.51	0.882
clpP	Streptococcus thermophilus LMD-9	91.282	95.588	0.873
clpP	Streptococcus thermophilus LMG 18311	91.282	95.588	0.873
clpP	Streptococcus pneumoniae Rx1	90.816	96.078	0.873
clpP	Streptococcus pneumoniae TIGR4	90.816	96.078	0.873
clpP	Streptococcus pneumoniae R6	90.816	96.078	0.873
clpP	Streptococcus pneumoniae D39	90.816	96.078	0.873
clpP	Streptococcus pyogenes JRS4	90.769	95.588	0.868
clpP	Streptococcus pyogenes MGAS315	90.769	95.588	0.868
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	85.641	95.588	0.819
clpP	Lactococcus lactis subsp. cremoris KW2	85.128	95.588	0.814
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	57.895	93.137	0.539
clpP	Bacillus subtilis subsp. subtilis str. 168	56.186	95.098	0.534

Detailed information NTG0789237