Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | POF59_RS03355 | Genome accession | NZ_CP116712 |
| Coordinates | 591173..591352 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae strain CNCTC 10/84 Cas9 AEKO | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 548865..592931 | 591173..591352 | within | 0 |
Gene organization within MGE regions
Location: 548865..592931
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| POF59_RS03065 (POF59_03065) | - | 548883..549722 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| POF59_RS03070 (POF59_03070) | - | 549697..550299 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| POF59_RS03075 (POF59_03075) | - | 550402..550677 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| POF59_RS03080 (POF59_03080) | - | 550765..551907 (-) | 1143 | WP_000269474.1 | site-specific integrase | - |
| POF59_RS03085 (POF59_03085) | - | 552022..552573 (-) | 552 | WP_000353929.1 | hypothetical protein | - |
| POF59_RS03090 (POF59_03090) | - | 552591..552977 (-) | 387 | WP_000151183.1 | ImmA/IrrE family metallo-endopeptidase | - |
| POF59_RS03095 (POF59_03095) | - | 552981..553328 (-) | 348 | WP_000493080.1 | helix-turn-helix transcriptional regulator | - |
| POF59_RS03100 (POF59_03100) | - | 553625..553870 (+) | 246 | WP_000739595.1 | hypothetical protein | - |
| POF59_RS03105 (POF59_03105) | - | 553821..554609 (-) | 789 | WP_000092751.1 | hypothetical protein | - |
| POF59_RS03110 (POF59_03110) | - | 554660..554851 (+) | 192 | WP_001112862.1 | hypothetical protein | - |
| POF59_RS03115 (POF59_03115) | - | 554931..555242 (+) | 312 | WP_001123483.1 | hypothetical protein | - |
| POF59_RS03120 (POF59_03120) | - | 555247..555396 (+) | 150 | WP_000732608.1 | hypothetical protein | - |
| POF59_RS03125 (POF59_03125) | - | 555390..555617 (+) | 228 | WP_000910901.1 | hypothetical protein | - |
| POF59_RS03130 (POF59_03130) | - | 555610..555840 (+) | 231 | WP_000573548.1 | hypothetical protein | - |
| POF59_RS03135 (POF59_03135) | - | 555824..557143 (+) | 1320 | WP_000156423.1 | AAA family ATPase | - |
| POF59_RS03140 (POF59_03140) | - | 557158..558252 (+) | 1095 | WP_001167562.1 | AAA family ATPase | - |
| POF59_RS03145 (POF59_03145) | - | 558292..558714 (+) | 423 | WP_000361801.1 | hypothetical protein | - |
| POF59_RS03150 (POF59_03150) | - | 558716..559450 (+) | 735 | WP_001293486.1 | hypothetical protein | - |
| POF59_RS03155 (POF59_03155) | - | 559471..560076 (+) | 606 | WP_038406062.1 | hypothetical protein | - |
| POF59_RS03160 (POF59_03160) | - | 560076..560684 (+) | 609 | WP_001876771.1 | hypothetical protein | - |
| POF59_RS03165 (POF59_03165) | - | 560690..562273 (+) | 1584 | WP_032457631.1 | DEAD/DEAH box helicase | - |
| POF59_RS03170 (POF59_03170) | - | 562282..562479 (+) | 198 | WP_000427885.1 | hypothetical protein | - |
| POF59_RS03175 (POF59_03175) | - | 562472..562723 (-) | 252 | WP_001114109.1 | hypothetical protein | - |
| POF59_RS03180 (POF59_03180) | - | 562794..565073 (+) | 2280 | WP_000829573.1 | AAA family ATPase | - |
| POF59_RS03185 (POF59_03185) | - | 565435..565653 (+) | 219 | WP_000388746.1 | hypothetical protein | - |
| POF59_RS03190 (POF59_03190) | - | 565646..566041 (+) | 396 | WP_000569002.1 | RusA family crossover junction endodeoxyribonuclease | - |
| POF59_RS03195 (POF59_03195) | - | 566038..566253 (+) | 216 | WP_000687319.1 | hypothetical protein | - |
| POF59_RS03200 (POF59_03200) | - | 566250..566486 (+) | 237 | WP_000145465.1 | DUF3310 domain-containing protein | - |
| POF59_RS03205 (POF59_03205) | - | 566483..566716 (+) | 234 | WP_001005354.1 | hypothetical protein | - |
| POF59_RS03210 (POF59_03210) | - | 566793..567206 (+) | 414 | WP_000041037.1 | transcriptional regulator | - |
| POF59_RS03215 (POF59_03215) | - | 567381..568133 (+) | 753 | WP_001075092.1 | TIR domain-containing protein | - |
| POF59_RS03220 (POF59_03220) | - | 568187..568618 (+) | 432 | WP_038406064.1 | terminase small subunit | - |
| POF59_RS03225 (POF59_03225) | - | 568608..569888 (+) | 1281 | WP_000208744.1 | PBSX family phage terminase large subunit | - |
| POF59_RS03230 (POF59_03230) | - | 569903..571432 (+) | 1530 | WP_000462947.1 | phage portal protein | - |
| POF59_RS03235 (POF59_03235) | - | 571392..572840 (+) | 1449 | WP_032457629.1 | phage head morphogenesis protein | - |
| POF59_RS10250 | - | 572868..573056 (+) | 189 | WP_025194292.1 | hypothetical protein | - |
| POF59_RS03240 (POF59_03240) | - | 573061..573264 (+) | 204 | WP_001042286.1 | hypothetical protein | - |
| POF59_RS03245 (POF59_03245) | - | 573407..573976 (+) | 570 | WP_000797011.1 | DUF4355 domain-containing protein | - |
| POF59_RS03250 (POF59_03250) | - | 573995..574891 (+) | 897 | WP_000818573.1 | hypothetical protein | - |
| POF59_RS03255 (POF59_03255) | - | 574897..575253 (+) | 357 | WP_000356704.1 | phage head-tail connector protein | - |
| POF59_RS03260 (POF59_03260) | - | 575264..575542 (+) | 279 | WP_000639436.1 | hypothetical protein | - |
| POF59_RS03265 (POF59_03265) | - | 575539..575883 (+) | 345 | WP_000060407.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| POF59_RS03270 (POF59_03270) | - | 575891..576250 (+) | 360 | WP_000331817.1 | hypothetical protein | - |
| POF59_RS03275 (POF59_03275) | - | 576262..576894 (+) | 633 | WP_000450518.1 | phage major tail protein, TP901-1 family | - |
| POF59_RS03280 (POF59_03280) | - | 576945..577400 (+) | 456 | WP_000424191.1 | tail assembly chaperone | - |
| POF59_RS03285 (POF59_03285) | - | 577475..577705 (+) | 231 | WP_000398752.1 | hypothetical protein | - |
| POF59_RS03290 (POF59_03290) | - | 577734..581960 (+) | 4227 | WP_000929199.1 | tape measure protein | - |
| POF59_RS03295 (POF59_03295) | - | 581973..582815 (+) | 843 | WP_000365119.1 | phage tail domain-containing protein | - |
| POF59_RS03300 (POF59_03300) | - | 582828..586655 (+) | 3828 | WP_000206521.1 | phage tail protein | - |
| POF59_RS03305 (POF59_03305) | - | 586664..586816 (+) | 153 | WP_000391486.1 | hypothetical protein | - |
| POF59_RS03310 (POF59_03310) | - | 586827..587243 (+) | 417 | WP_001870768.1 | DUF1366 domain-containing protein | - |
| POF59_RS03315 (POF59_03315) | - | 587306..587467 (+) | 162 | WP_000222555.1 | hypothetical protein | - |
| POF59_RS03320 (POF59_03320) | - | 587477..587767 (+) | 291 | WP_000564986.1 | hypothetical protein | - |
| POF59_RS03325 (POF59_03325) | - | 587769..588020 (+) | 252 | WP_000611525.1 | phage holin | - |
| POF59_RS03330 (POF59_03330) | - | 588140..589333 (+) | 1194 | WP_000143381.1 | glucosaminidase domain-containing protein | - |
| POF59_RS03335 (POF59_03335) | - | 589699..590214 (+) | 516 | WP_000837684.1 | hypothetical protein | - |
| POF59_RS03340 (POF59_03340) | - | 590342..590542 (+) | 201 | WP_000076712.1 | CsbD family protein | - |
| POF59_RS03345 (POF59_03345) | - | 590583..590753 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| POF59_RS03350 (POF59_03350) | - | 590889..591014 (-) | 126 | WP_017646884.1 | hypothetical protein | - |
| POF59_RS03355 (POF59_03355) | prx | 591173..591352 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
| POF59_RS03360 (POF59_03360) | - | 591758..591955 (+) | 198 | WP_001290370.1 | hypothetical protein | - |
| POF59_RS03365 (POF59_03365) | - | 591999..592931 (-) | 933 | WP_000254064.1 | dihydroorotate oxidase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=779521 POF59_RS03355 WP_000965651.1 591173..591352(+) (prx) [Streptococcus agalactiae strain CNCTC 10/84 Cas9 AEKO]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=779521 POF59_RS03355 WP_000965651.1 591173..591352(+) (prx) [Streptococcus agalactiae strain CNCTC 10/84 Cas9 AEKO]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |