Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | POF62_RS03330 | Genome accession | NZ_CP116707 |
| Coordinates | 585900..586079 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae strain A909 sCas9revertant | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 547064..586079 | 585900..586079 | within | 0 |
Gene organization within MGE regions
Location: 547064..586079
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| POF62_RS03030 (POF62_03030) | - | 547082..547921 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| POF62_RS03035 (POF62_03035) | - | 547896..548498 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| POF62_RS03040 (POF62_03040) | - | 548601..548876 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| POF62_RS03045 (POF62_03045) | - | 548964..550106 (-) | 1143 | WP_000269476.1 | site-specific integrase | - |
| POF62_RS03050 (POF62_03050) | - | 550234..550443 (-) | 210 | WP_000442169.1 | TM2 domain-containing protein | - |
| POF62_RS03055 (POF62_03055) | - | 550495..550875 (-) | 381 | WP_000700104.1 | ImmA/IrrE family metallo-endopeptidase | - |
| POF62_RS03060 (POF62_03060) | - | 550862..551221 (-) | 360 | WP_000555955.1 | helix-turn-helix transcriptional regulator | - |
| POF62_RS03065 (POF62_03065) | - | 551413..551631 (+) | 219 | WP_000257547.1 | helix-turn-helix transcriptional regulator | - |
| POF62_RS03070 (POF62_03070) | - | 551640..551717 (+) | 78 | Protein_521 | phage antirepressor Ant | - |
| POF62_RS03075 (POF62_03075) | - | 551729..552061 (+) | 333 | WP_000158652.1 | hypothetical protein | - |
| POF62_RS03080 (POF62_03080) | - | 552166..552501 (-) | 336 | WP_000360288.1 | hypothetical protein | - |
| POF62_RS03085 (POF62_03085) | - | 552647..552832 (+) | 186 | WP_000263692.1 | helix-turn-helix transcriptional regulator | - |
| POF62_RS03090 (POF62_03090) | - | 552911..553222 (+) | 312 | WP_001123481.1 | hypothetical protein | - |
| POF62_RS03095 (POF62_03095) | - | 553227..553376 (+) | 150 | WP_000732607.1 | hypothetical protein | - |
| POF62_RS03100 (POF62_03100) | - | 553452..553652 (+) | 201 | WP_001058282.1 | hypothetical protein | - |
| POF62_RS03105 (POF62_03105) | - | 553649..553939 (+) | 291 | WP_000650504.1 | hypothetical protein | - |
| POF62_RS03110 (POF62_03110) | - | 553926..554609 (+) | 684 | WP_000704949.1 | AAA family ATPase | - |
| POF62_RS03120 (POF62_03120) | - | 554615..556048 (+) | 1434 | Protein_530 | DEAD/DEAH box helicase | - |
| POF62_RS03125 (POF62_03125) | - | 556053..556535 (+) | 483 | WP_000896928.1 | DUF669 domain-containing protein | - |
| POF62_RS03130 (POF62_03130) | - | 556553..558106 (+) | 1554 | WP_000203210.1 | hypothetical protein | - |
| POF62_RS03135 (POF62_03135) | - | 558375..559244 (+) | 870 | WP_000274892.1 | bifunctional DNA primase/polymerase | - |
| POF62_RS03140 (POF62_03140) | - | 559264..559545 (+) | 282 | WP_001866078.1 | VRR-NUC domain-containing protein | - |
| POF62_RS03145 (POF62_03145) | - | 559624..559920 (+) | 297 | WP_000763908.1 | nucleotide modification associated domain-containing protein | - |
| POF62_RS03150 (POF62_03150) | - | 559904..560143 (+) | 240 | WP_000150115.1 | hypothetical protein | - |
| POF62_RS03155 (POF62_03155) | - | 560174..560338 (+) | 165 | WP_000159368.1 | hypothetical protein | - |
| POF62_RS03160 (POF62_03160) | - | 560335..560604 (+) | 270 | WP_000139628.1 | hypothetical protein | - |
| POF62_RS03165 (POF62_03165) | - | 560608..560751 (+) | 144 | WP_000564605.1 | hypothetical protein | - |
| POF62_RS03170 (POF62_03170) | - | 560748..561260 (+) | 513 | WP_001019149.1 | DUF1642 domain-containing protein | - |
| POF62_RS03175 (POF62_03175) | - | 561281..561580 (+) | 300 | WP_001105090.1 | hypothetical protein | - |
| POF62_RS03180 (POF62_03180) | - | 561768..561962 (+) | 195 | WP_000221696.1 | hypothetical protein | - |
| POF62_RS03185 (POF62_03185) | - | 561959..562225 (+) | 267 | WP_000660741.1 | hypothetical protein | - |
| POF62_RS03190 (POF62_03190) | - | 562616..563041 (+) | 426 | WP_000533370.1 | DUF1492 domain-containing protein | - |
| POF62_RS03195 (POF62_03195) | - | 563610..563987 (+) | 378 | WP_017646473.1 | HNH endonuclease signature motif containing protein | - |
| POF62_RS03200 (POF62_03200) | - | 564138..564494 (+) | 357 | WP_000725958.1 | hypothetical protein | - |
| POF62_RS03205 (POF62_03205) | - | 564491..565759 (+) | 1269 | WP_001108673.1 | phage portal protein | - |
| POF62_RS03210 (POF62_03210) | - | 565752..566972 (+) | 1221 | WP_000227335.1 | polymorphic toxin type 50 domain-containing protein | - |
| POF62_RS03215 (POF62_03215) | - | 566972..567160 (+) | 189 | WP_000421991.1 | hypothetical protein | - |
| POF62_RS03220 (POF62_03220) | - | 567268..568683 (+) | 1416 | WP_000256854.1 | terminase large subunit | - |
| POF62_RS03225 (POF62_03225) | - | 568764..569228 (+) | 465 | WP_001288696.1 | DUF4355 domain-containing protein | - |
| POF62_RS03230 (POF62_03230) | - | 569231..570133 (+) | 903 | WP_000841024.1 | phage major capsid protein | - |
| POF62_RS03235 (POF62_03235) | - | 570130..570345 (+) | 216 | WP_000640308.1 | hypothetical protein | - |
| POF62_RS03240 (POF62_03240) | - | 570359..570790 (+) | 432 | WP_000180799.1 | phage Gp19/Gp15/Gp42 family protein | - |
| POF62_RS03245 (POF62_03245) | - | 570741..571079 (+) | 339 | WP_001096306.1 | hypothetical protein | - |
| POF62_RS03250 (POF62_03250) | - | 571072..571308 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| POF62_RS03255 (POF62_03255) | - | 571309..571644 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| POF62_RS03260 (POF62_03260) | - | 571654..572211 (+) | 558 | WP_000226353.1 | tail protein | - |
| POF62_RS03265 (POF62_03265) | - | 572211..572456 (+) | 246 | WP_000858406.1 | hypothetical protein | - |
| POF62_RS03270 (POF62_03270) | - | 572471..572842 (+) | 372 | WP_000916438.1 | DUF5361 domain-containing protein | - |
| POF62_RS03275 (POF62_03275) | - | 572842..574854 (+) | 2013 | WP_000224696.1 | hypothetical protein | - |
| POF62_RS03280 (POF62_03280) | - | 574848..576380 (+) | 1533 | WP_000228808.1 | distal tail protein Dit | - |
| POF62_RS03285 (POF62_03285) | - | 576381..580502 (+) | 4122 | WP_000955545.1 | glucosaminidase domain-containing protein | - |
| POF62_RS03290 (POF62_03290) | - | 580503..582506 (+) | 2004 | WP_000206874.1 | DUF859 family phage minor structural protein | - |
| POF62_RS03295 (POF62_03295) | - | 582518..582910 (+) | 393 | WP_000889198.1 | DUF1366 domain-containing protein | - |
| POF62_RS03300 (POF62_03300) | - | 582933..583061 (+) | 129 | WP_000973385.1 | hypothetical protein | - |
| POF62_RS03305 (POF62_03305) | - | 583070..583372 (+) | 303 | WP_001017826.1 | hypothetical protein | - |
| POF62_RS03310 (POF62_03310) | - | 583365..583592 (+) | 228 | WP_000609111.1 | phage holin | - |
| POF62_RS03315 (POF62_03315) | - | 583718..585049 (+) | 1332 | WP_000257237.1 | GH25 family lysozyme | - |
| POF62_RS03320 (POF62_03320) | - | 585311..585481 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| POF62_RS03325 (POF62_03325) | - | 585617..585742 (-) | 126 | WP_017285425.1 | hypothetical protein | - |
| POF62_RS03330 (POF62_03330) | prx | 585900..586079 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=779258 POF62_RS03330 WP_000965651.1 585900..586079(+) (prx) [Streptococcus agalactiae strain A909 sCas9revertant]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=779258 POF62_RS03330 WP_000965651.1 585900..586079(+) (prx) [Streptococcus agalactiae strain A909 sCas9revertant]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |