Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | POF60_RS03355 | Genome accession | NZ_CP116705 |
| Coordinates | 591185..591364 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae strain CNCTC 10/84 dCas9 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 546295..591967 | 591185..591364 | within | 0 |
Gene organization within MGE regions
Location: 546295..591967
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| POF60_RS03055 (POF60_03055) | recN | 546295..547953 (+) | 1659 | WP_000923615.1 | DNA repair protein RecN | - |
| POF60_RS03060 (POF60_03060) | - | 548066..548902 (+) | 837 | WP_000034835.1 | DegV family protein | - |
| POF60_RS03065 (POF60_03065) | - | 548895..549734 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| POF60_RS03070 (POF60_03070) | - | 549709..550311 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| POF60_RS03075 (POF60_03075) | - | 550414..550689 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| POF60_RS03080 (POF60_03080) | - | 550777..551919 (-) | 1143 | WP_000269474.1 | site-specific integrase | - |
| POF60_RS03085 (POF60_03085) | - | 552034..552585 (-) | 552 | WP_000353929.1 | hypothetical protein | - |
| POF60_RS03090 (POF60_03090) | - | 552603..552989 (-) | 387 | WP_000151183.1 | ImmA/IrrE family metallo-endopeptidase | - |
| POF60_RS03095 (POF60_03095) | - | 552993..553340 (-) | 348 | WP_000493080.1 | helix-turn-helix transcriptional regulator | - |
| POF60_RS03100 (POF60_03100) | - | 553637..553882 (+) | 246 | WP_000739595.1 | hypothetical protein | - |
| POF60_RS03105 (POF60_03105) | - | 553833..554621 (-) | 789 | WP_000092751.1 | hypothetical protein | - |
| POF60_RS03110 (POF60_03110) | - | 554672..554863 (+) | 192 | WP_001112862.1 | hypothetical protein | - |
| POF60_RS03115 (POF60_03115) | - | 554943..555254 (+) | 312 | WP_001123483.1 | hypothetical protein | - |
| POF60_RS03120 (POF60_03120) | - | 555259..555408 (+) | 150 | WP_000732608.1 | hypothetical protein | - |
| POF60_RS03125 (POF60_03125) | - | 555402..555629 (+) | 228 | WP_000910901.1 | hypothetical protein | - |
| POF60_RS03130 (POF60_03130) | - | 555622..555852 (+) | 231 | WP_000573548.1 | hypothetical protein | - |
| POF60_RS03135 (POF60_03135) | - | 555836..557155 (+) | 1320 | WP_000156423.1 | AAA family ATPase | - |
| POF60_RS03140 (POF60_03140) | - | 557170..558264 (+) | 1095 | WP_001167562.1 | AAA family ATPase | - |
| POF60_RS03145 (POF60_03145) | - | 558304..558726 (+) | 423 | WP_000361801.1 | hypothetical protein | - |
| POF60_RS03150 (POF60_03150) | - | 558728..559462 (+) | 735 | WP_001293486.1 | hypothetical protein | - |
| POF60_RS03155 (POF60_03155) | - | 559483..560088 (+) | 606 | WP_038406062.1 | hypothetical protein | - |
| POF60_RS03160 (POF60_03160) | - | 560088..560696 (+) | 609 | WP_001876771.1 | hypothetical protein | - |
| POF60_RS03165 (POF60_03165) | - | 560702..562285 (+) | 1584 | WP_032457631.1 | DEAD/DEAH box helicase | - |
| POF60_RS03170 (POF60_03170) | - | 562294..562491 (+) | 198 | WP_000427885.1 | hypothetical protein | - |
| POF60_RS03175 (POF60_03175) | - | 562484..562735 (-) | 252 | WP_001114109.1 | hypothetical protein | - |
| POF60_RS03180 (POF60_03180) | - | 562806..565085 (+) | 2280 | WP_000829573.1 | AAA family ATPase | - |
| POF60_RS03185 (POF60_03185) | - | 565447..565665 (+) | 219 | WP_000388746.1 | hypothetical protein | - |
| POF60_RS03190 (POF60_03190) | - | 565658..566053 (+) | 396 | WP_000569002.1 | RusA family crossover junction endodeoxyribonuclease | - |
| POF60_RS03195 (POF60_03195) | - | 566050..566265 (+) | 216 | WP_000687319.1 | hypothetical protein | - |
| POF60_RS03200 (POF60_03200) | - | 566262..566498 (+) | 237 | WP_000145465.1 | DUF3310 domain-containing protein | - |
| POF60_RS03205 (POF60_03205) | - | 566495..566728 (+) | 234 | WP_001005354.1 | hypothetical protein | - |
| POF60_RS03210 (POF60_03210) | - | 566805..567218 (+) | 414 | WP_000041037.1 | transcriptional regulator | - |
| POF60_RS03215 (POF60_03215) | - | 567393..568145 (+) | 753 | WP_001075092.1 | TIR domain-containing protein | - |
| POF60_RS03220 (POF60_03220) | - | 568199..568630 (+) | 432 | WP_038406064.1 | terminase small subunit | - |
| POF60_RS03225 (POF60_03225) | - | 568620..569900 (+) | 1281 | WP_000208744.1 | PBSX family phage terminase large subunit | - |
| POF60_RS03230 (POF60_03230) | - | 569915..571444 (+) | 1530 | WP_000462947.1 | phage portal protein | - |
| POF60_RS03235 (POF60_03235) | - | 571404..572852 (+) | 1449 | WP_032457629.1 | phage head morphogenesis protein | - |
| POF60_RS10270 | - | 572880..573068 (+) | 189 | WP_025194292.1 | hypothetical protein | - |
| POF60_RS03240 (POF60_03240) | - | 573073..573276 (+) | 204 | WP_001042286.1 | hypothetical protein | - |
| POF60_RS03245 (POF60_03245) | - | 573419..573988 (+) | 570 | WP_000797011.1 | DUF4355 domain-containing protein | - |
| POF60_RS03250 (POF60_03250) | - | 574007..574903 (+) | 897 | WP_000818573.1 | hypothetical protein | - |
| POF60_RS03255 (POF60_03255) | - | 574909..575265 (+) | 357 | WP_000356704.1 | phage head-tail connector protein | - |
| POF60_RS03260 (POF60_03260) | - | 575276..575554 (+) | 279 | WP_000639436.1 | hypothetical protein | - |
| POF60_RS03265 (POF60_03265) | - | 575551..575895 (+) | 345 | WP_000060407.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| POF60_RS03270 (POF60_03270) | - | 575903..576262 (+) | 360 | WP_000331817.1 | hypothetical protein | - |
| POF60_RS03275 (POF60_03275) | - | 576274..576906 (+) | 633 | WP_000450518.1 | phage major tail protein, TP901-1 family | - |
| POF60_RS03280 (POF60_03280) | - | 576957..577412 (+) | 456 | WP_000424191.1 | tail assembly chaperone | - |
| POF60_RS03285 (POF60_03285) | - | 577487..577717 (+) | 231 | WP_000398752.1 | hypothetical protein | - |
| POF60_RS03290 (POF60_03290) | - | 577746..581972 (+) | 4227 | WP_000929199.1 | tape measure protein | - |
| POF60_RS03295 (POF60_03295) | - | 581985..582827 (+) | 843 | WP_000365119.1 | phage tail domain-containing protein | - |
| POF60_RS03300 (POF60_03300) | - | 582840..586667 (+) | 3828 | WP_000206521.1 | phage tail protein | - |
| POF60_RS03305 (POF60_03305) | - | 586676..586828 (+) | 153 | WP_000391486.1 | hypothetical protein | - |
| POF60_RS03310 (POF60_03310) | - | 586839..587255 (+) | 417 | WP_001870768.1 | DUF1366 domain-containing protein | - |
| POF60_RS03315 (POF60_03315) | - | 587318..587479 (+) | 162 | WP_000222555.1 | hypothetical protein | - |
| POF60_RS03320 (POF60_03320) | - | 587489..587779 (+) | 291 | WP_000564986.1 | hypothetical protein | - |
| POF60_RS03325 (POF60_03325) | - | 587781..588032 (+) | 252 | WP_000611525.1 | phage holin | - |
| POF60_RS03330 (POF60_03330) | - | 588152..589345 (+) | 1194 | WP_000143381.1 | glucosaminidase domain-containing protein | - |
| POF60_RS03335 (POF60_03335) | - | 589711..590226 (+) | 516 | WP_000837684.1 | hypothetical protein | - |
| POF60_RS03340 (POF60_03340) | - | 590354..590554 (+) | 201 | WP_000076712.1 | CsbD family protein | - |
| POF60_RS03345 (POF60_03345) | - | 590595..590765 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| POF60_RS03350 (POF60_03350) | - | 590901..591026 (-) | 126 | WP_017646884.1 | hypothetical protein | - |
| POF60_RS03355 (POF60_03355) | prx | 591185..591364 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
| POF60_RS03360 (POF60_03360) | - | 591770..591967 (+) | 198 | WP_001290370.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=779154 POF60_RS03355 WP_000965651.1 591185..591364(+) (prx) [Streptococcus agalactiae strain CNCTC 10/84 dCas9]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=779154 POF60_RS03355 WP_000965651.1 591185..591364(+) (prx) [Streptococcus agalactiae strain CNCTC 10/84 dCas9]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |