Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | PJW02_RS04040 | Genome accession | NZ_CP116313 |
| Coordinates | 785403..785984 (-) | Length | 193 a.a. |
| NCBI ID | WP_001049162.1 | Uniprot ID | A0A9W5QPC2 |
| Organism | Bacillus thuringiensis strain Lip | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 785403..828016 | 785403..785984 | within | 0 |
Gene organization within MGE regions
Location: 785403..828016
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJW02_RS04040 (PJW02_04040) | clpP | 785403..785984 (-) | 582 | WP_001049162.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
| PJW02_RS04045 (PJW02_04045) | - | 786225..787094 (-) | 870 | WP_000018924.1 | DUF421 domain-containing protein | - |
| PJW02_RS04050 (PJW02_04050) | - | 787115..787321 (-) | 207 | WP_000215909.1 | DUF1657 domain-containing protein | - |
| PJW02_RS04055 (PJW02_04055) | spoVAE | 787333..787683 (-) | 351 | WP_000575919.1 | stage V sporulation protein AE | - |
| PJW02_RS04060 (PJW02_04060) | spoVAD | 787680..788696 (-) | 1017 | WP_000938972.1 | stage V sporulation protein AD | - |
| PJW02_RS04065 (PJW02_04065) | spoVAC | 788697..789173 (-) | 477 | WP_000095408.1 | stage V sporulation protein AC | - |
| PJW02_RS04070 (PJW02_04070) | - | 789203..789691 (-) | 489 | WP_001226064.1 | YhcN/YlaJ family sporulation lipoprotein | - |
| PJW02_RS04075 (PJW02_04075) | - | 789785..789991 (-) | 207 | WP_000216166.1 | DUF1657 domain-containing protein | - |
| PJW02_RS04085 (PJW02_04085) | - | 790406..791542 (-) | 1137 | WP_038413879.1 | tyrosine-type recombinase/integrase | - |
| PJW02_RS04090 (PJW02_04090) | - | 791573..792040 (-) | 468 | WP_038413877.1 | hypothetical protein | - |
| PJW02_RS04095 (PJW02_04095) | - | 792051..792443 (-) | 393 | WP_023523448.1 | helix-turn-helix domain-containing protein | - |
| PJW02_RS04100 (PJW02_04100) | - | 792608..792838 (+) | 231 | WP_000216290.1 | helix-turn-helix transcriptional regulator | - |
| PJW02_RS04105 (PJW02_04105) | - | 792873..793106 (+) | 234 | WP_023523446.1 | DUF771 domain-containing protein | - |
| PJW02_RS04110 (PJW02_04110) | - | 793165..793332 (+) | 168 | WP_172965764.1 | hypothetical protein | - |
| PJW02_RS04115 (PJW02_04115) | - | 793333..793560 (+) | 228 | WP_038413873.1 | hypothetical protein | - |
| PJW02_RS04120 (PJW02_04120) | - | 793561..793911 (+) | 351 | WP_001209506.1 | YqaI family protein | - |
| PJW02_RS04125 (PJW02_04125) | - | 793932..794579 (+) | 648 | WP_003280171.1 | sigma-70 family RNA polymerase sigma factor | - |
| PJW02_RS04130 (PJW02_04130) | - | 794642..794797 (+) | 156 | WP_021727747.1 | DUF6906 family protein | - |
| PJW02_RS04135 (PJW02_04135) | - | 794813..795016 (+) | 204 | WP_038413868.1 | hypothetical protein | - |
| PJW02_RS04140 (PJW02_04140) | - | 795016..795297 (+) | 282 | WP_038413866.1 | hypothetical protein | - |
| PJW02_RS04145 (PJW02_04145) | - | 795275..795826 (+) | 552 | WP_038413864.1 | host-nuclease inhibitor Gam family protein | - |
| PJW02_RS04150 (PJW02_04150) | - | 795829..796425 (+) | 597 | WP_038413862.1 | hypothetical protein | - |
| PJW02_RS04155 (PJW02_04155) | - | 796441..797133 (+) | 693 | WP_038413860.1 | AAA family ATPase | - |
| PJW02_RS04160 (PJW02_04160) | - | 797133..797612 (+) | 480 | WP_038413858.1 | DUF669 domain-containing protein | - |
| PJW02_RS04165 (PJW02_04165) | - | 797679..798059 (+) | 381 | WP_038413856.1 | zinc-finger-containing protein | - |
| PJW02_RS04170 (PJW02_04170) | - | 798056..800410 (+) | 2355 | WP_038413854.1 | phage/plasmid primase, P4 family | - |
| PJW02_RS04175 (PJW02_04175) | - | 800676..801104 (+) | 429 | WP_038413852.1 | hypothetical protein | - |
| PJW02_RS04180 (PJW02_04180) | - | 801107..801481 (+) | 375 | WP_080703607.1 | YopX family protein | - |
| PJW02_RS04185 (PJW02_04185) | - | 801478..802017 (+) | 540 | WP_000617754.1 | ERCC4 domain-containing protein | - |
| PJW02_RS04190 (PJW02_04190) | - | 802019..802291 (+) | 273 | WP_000331834.1 | hypothetical protein | - |
| PJW02_RS04195 (PJW02_04195) | - | 802343..802780 (+) | 438 | WP_000169951.1 | hypothetical protein | - |
| PJW02_RS04200 (PJW02_04200) | - | 802850..803113 (+) | 264 | WP_001216580.1 | hypothetical protein | - |
| PJW02_RS04205 (PJW02_04205) | - | 803149..803448 (+) | 300 | WP_038413846.1 | hypothetical protein | - |
| PJW02_RS04210 (PJW02_04210) | - | 803622..803795 (+) | 174 | WP_198319674.1 | DUF6877 family protein | - |
| PJW02_RS04215 (PJW02_04215) | - | 803837..804223 (+) | 387 | WP_038413844.1 | phage protein | - |
| PJW02_RS04220 (PJW02_04220) | - | 804423..804812 (+) | 390 | WP_038413842.1 | DUF3942 family protein | - |
| PJW02_RS04225 (PJW02_04225) | - | 805125..805295 (+) | 171 | WP_172965765.1 | hypothetical protein | - |
| PJW02_RS04230 (PJW02_04230) | - | 805436..805633 (+) | 198 | WP_038413982.1 | hypothetical protein | - |
| PJW02_RS04235 (PJW02_04235) | - | 805679..805900 (+) | 222 | WP_038413841.1 | hypothetical protein | - |
| PJW02_RS04240 (PJW02_04240) | - | 805897..806220 (+) | 324 | WP_038413839.1 | phage protein | - |
| PJW02_RS04245 (PJW02_04245) | - | 806217..806609 (+) | 393 | WP_038413837.1 | HNH endonuclease | - |
| PJW02_RS04250 (PJW02_04250) | - | 806694..807131 (+) | 438 | WP_038413835.1 | P27 family phage terminase small subunit | - |
| PJW02_RS04255 (PJW02_04255) | - | 807128..808855 (+) | 1728 | WP_038413833.1 | terminase large subunit | - |
| PJW02_RS04260 (PJW02_04260) | - | 808871..810076 (+) | 1206 | WP_038413832.1 | phage portal protein | - |
| PJW02_RS04265 (PJW02_04265) | - | 810045..810623 (+) | 579 | WP_038413830.1 | HK97 family phage prohead protease | - |
| PJW02_RS04270 (PJW02_04270) | - | 810625..811992 (+) | 1368 | WP_038413828.1 | phage major capsid protein | - |
| PJW02_RS04275 (PJW02_04275) | - | 811994..812254 (+) | 261 | WP_038413826.1 | head-tail connector protein | - |
| PJW02_RS04280 (PJW02_04280) | - | 812235..812564 (+) | 330 | WP_374203651.1 | hypothetical protein | - |
| PJW02_RS04285 (PJW02_04285) | - | 812554..812883 (+) | 330 | WP_038413822.1 | hypothetical protein | - |
| PJW02_RS04290 (PJW02_04290) | - | 812883..813260 (+) | 378 | WP_038413820.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| PJW02_RS04295 (PJW02_04295) | - | 813272..813907 (+) | 636 | WP_038413819.1 | major tail protein | - |
| PJW02_RS04300 (PJW02_04300) | - | 813919..814305 (+) | 387 | WP_000113342.1 | hypothetical protein | - |
| PJW02_RS04305 (PJW02_04305) | - | 814549..818070 (+) | 3522 | WP_038413816.1 | phage tail tape measure protein | - |
| PJW02_RS04310 (PJW02_04310) | - | 818072..818755 (+) | 684 | WP_038413814.1 | phage tail domain-containing protein | - |
| PJW02_RS04315 (PJW02_04315) | - | 818752..821094 (+) | 2343 | WP_038413812.1 | phage tail spike protein | - |
| PJW02_RS04320 (PJW02_04320) | - | 821109..822389 (+) | 1281 | WP_038413811.1 | BppU family phage baseplate upper protein | - |
| PJW02_RS04325 (PJW02_04325) | - | 822439..822648 (+) | 210 | WP_038413980.1 | hemolysin XhlA family protein | - |
| PJW02_RS04330 (PJW02_04330) | - | 822650..822853 (+) | 204 | WP_038413810.1 | hypothetical protein | - |
| PJW02_RS04335 (PJW02_04335) | - | 822850..823902 (+) | 1053 | WP_038413809.1 | N-acetylmuramoyl-L-alanine amidase | - |
| PJW02_RS04340 (PJW02_04340) | - | 824081..824413 (-) | 333 | WP_038413808.1 | hypothetical protein | - |
| PJW02_RS04345 (PJW02_04345) | - | 824492..824740 (-) | 249 | WP_038413806.1 | hypothetical protein | - |
| PJW02_RS04350 (PJW02_04350) | - | 824755..824961 (-) | 207 | Protein_796 | helix-turn-helix domain-containing protein | - |
| PJW02_RS04355 (PJW02_04355) | - | 825054..825887 (-) | 834 | WP_038413978.1 | hypothetical protein | - |
| PJW02_RS04360 (PJW02_04360) | rpoN | 826454..827761 (+) | 1308 | WP_000647955.1 | RNA polymerase factor sigma-54 | - |
| PJW02_RS04365 (PJW02_04365) | - | 827771..828016 (+) | 246 | WP_000869730.1 | glutaredoxin family protein | - |
Sequence
Protein
Download Length: 193 a.a. Molecular weight: 21419.67 Da Isoelectric Point: 5.0423
>NTDB_id=776555 PJW02_RS04040 WP_001049162.1 785403..785984(-) (clpP) [Bacillus thuringiensis strain Lip]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLESQDPEKDIHIYINSPGGSITAGMAIYDT
MQFIKPQVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNQILADRTGQ
PLEVLQRDTDRDNFMTAEKALEYGLIDKIFTNR
Nucleotide
Download Length: 582 bp
>NTDB_id=776555 PJW02_RS04040 WP_001049162.1 785403..785984(-) (clpP) [Bacillus thuringiensis strain Lip]
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAAATCTTTACAAATCGTTAA
ATGAATTTAATTCCTACAGTAATTGAACAAACAAATCGTGGAGAACGCGCTTACGATATTTACTCTCGACTATTAAAAGA
CCGCATCATTATGCTTGGTAGTGCAATTGATGACAACGTAGCTAACTCAATCGTTTCCCAGCTTTTATTCTTGGAATCTC
AAGATCCAGAAAAAGATATTCACATCTACATCAACAGCCCTGGTGGTTCTATCACAGCAGGTATGGCAATCTATGATACA
ATGCAGTTTATTAAACCACAAGTATCAACAATCTGTATCGGTATGGCAGCATCTATGGGTGCATTCTTACTTGCAGCAGG
TGAAAAAGGAAAACGTTATGCACTTCCAAACAGTGAAGTAATGATTCACCAACCACTTGGCGGAGCACAAGGTCAAGCGA
CTGAAATCGAAATCGCTGCAAAACGTATCCTATTCTTACGTGAAAAACTAAACCAAATTCTTGCTGACCGCACTGGTCAA
CCACTTGAAGTACTACAACGCGACACAGACCGCGACAACTTCATGACAGCAGAAAAAGCTTTAGAATACGGTTTAATCGA
TAAAATCTTTACAAATCGTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
90.104 |
99.482 |
0.896 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
67.021 |
97.409 |
0.653 |
| clpP | Streptococcus thermophilus LMG 18311 |
60.417 |
99.482 |
0.601 |
| clpP | Streptococcus thermophilus LMD-9 |
60.417 |
99.482 |
0.601 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
58.854 |
99.482 |
0.585 |
| clpP | Streptococcus pneumoniae D39 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae Rx1 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae R6 |
57.292 |
99.482 |
0.57 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.292 |
99.482 |
0.57 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
56.771 |
99.482 |
0.565 |
| clpP | Streptococcus pyogenes JRS4 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus pyogenes MGAS315 |
55.729 |
99.482 |
0.554 |
| clpP | Streptococcus mutans UA159 |
55.44 |
100 |
0.554 |