Detailed information NTG0774599

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: PG907_RS03050
• Genome accession: NZ_CP115955
• Coordinates: 650099..650605 (+)
• Length: 168 a.a.
• NCBI ID: WP_193026451.1
• Uniprot ID: -
• Organism: Ralstonia pseudosolanacearum strain RUN2340
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	650886..660359	650099..650605	flank	281

Gene organization within MGE regions

Location: 650099..660359

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PG907_RS03050	pilA	650099..650605 (+)	507	WP_193026451.1	pilin	Machinery gene
PG907_RS03055	-	650679..652412 (+)	1734	WP_193028552.1	PglL family O-oligosaccharyltransferase	-
PG907_RS03060	moaC	652484..652960 (-)	477	WP_193026450.1	cyclic pyranopterin monophosphate synthase MoaC	-
PG907_RS03065	-	653054..654742 (+)	1689	WP_193026449.1	tetratricopeptide repeat protein	-
PG907_RS03070	-	654757..655344 (-)	588	WP_275760671.1	DUF2946 family protein	-
PG907_RS03075	-	655337..656452 (-)	1116	WP_197366210.1	YheT family hydrolase	-
PG907_RS03080	-	656492..656932 (-)	441	WP_003278969.1	nuclear transport factor 2 family protein	-
PG907_RS03085	waaF	656972..657997 (-)	1026	WP_020749591.1	lipopolysaccharide heptosyltransferase II	-
PG907_RS03090	-	658047..658244 (-)	198	WP_011000524.1	zinc-finger domain-containing protein	-
PG907_RS03095	-	658269..659198 (-)	930	WP_020749589.1	branched-chain amino acid transaminase	-
PG907_RS03100	-	659353..660087 (-)	735	Protein_618	IS630 family transposase	-
PG907_RS03105	-	660021..660359 (-)	339	Protein_619	helix-turn-helix domain-containing protein	-

Sequence

Protein

• Length: 168 a.a.
• Molecular weight: 16971.66 Da
• Isoelectric Point: 9.9490

>NTDB_id=774599 PG907_RS03050 WP_193026451.1 650099..650605(+) (pilA) [Ralstonia pseudosolanacearum strain RUN2340]
MKSMRLNKRVQKGFTLIELMIVVAIVGILAAIAIPAYQDYTVRARVTEGLSLAAQAKALVSENAANAQTDLSVGSSVFTP
TKNVANLAIDGTTAGVPGQITVTYTTAAGGGTLALVPTAAGAKLPTGSAPSGPIMWTCYAAGKATAASSVNPNATMTLAA
KYAPAECR

Nucleotide

• Length: 507 bp

>NTDB_id=774599 PG907_RS03050 WP_193026451.1 650099..650605(+) (pilA) [Ralstonia pseudosolanacearum strain RUN2340]
ATGAAGTCGATGCGTCTCAACAAGCGTGTCCAAAAGGGTTTCACGCTGATCGAACTGATGATCGTGGTCGCGATCGTCGG
TATTCTGGCTGCGATTGCCATTCCGGCCTATCAGGACTACACGGTTCGTGCACGCGTGACGGAAGGCCTGTCGCTGGCTG
CGCAAGCCAAGGCACTGGTGTCGGAAAACGCTGCCAATGCACAAACTGACCTGTCGGTAGGTTCGTCGGTGTTCACGCCC
ACCAAGAACGTTGCAAACCTTGCAATTGATGGCACTACGGCTGGTGTTCCGGGCCAGATCACCGTGACCTATACGACGGC
AGCCGGCGGCGGCACGCTGGCTCTGGTCCCGACCGCGGCAGGCGCTAAGCTGCCGACGGGTTCGGCTCCGTCGGGTCCGA
TCATGTGGACCTGCTACGCTGCGGGTAAGGCTACGGCCGCCAGCAGCGTTAATCCGAACGCTACGATGACGCTGGCAGCG
AAGTATGCTCCGGCAGAATGCCGCTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (42-168)

• Prokaryotic N-terminal methylation motif (N_methyl) (9-33)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Ralstonia pseudosolanacearum GMI1000	89.349	100	0.899
pilA2	Legionella pneumophila str. Paris	51.235	96.429	0.494
pilA2	Legionella pneumophila strain ERS1305867	50.617	96.429	0.488
comP	Acinetobacter baylyi ADP1	44.97	100	0.452
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	38.462	100	0.446
pilA/pilA1	Eikenella corrodens VA1	41.176	91.071	0.375
pilA/pilAI	Pseudomonas stutzeri DSM 10701	34.659	100	0.363