Detailed information
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | OTB22_RS10880 | Genome accession | NZ_CP113267 |
| Coordinates | 2125305..2125430 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799689.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain BC2 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2120305..2130430
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OTB22_RS11130 | - | 2121141..2122318 (-) | 1178 | Protein_2106 | YhgE/Pip family protein | - |
| OTB22_RS10855 (OTB22_10860) | - | 2122425..2122967 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| OTB22_RS10870 (OTB22_10875) | comE | 2123210..2123962 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| OTB22_RS10875 (OTB22_10880) | comD/comD1 | 2123959..2125284 (-) | 1326 | WP_000362880.1 | competence system sensor histidine kinase ComD | Regulator |
| OTB22_RS10880 (OTB22_10885) | comC/comC1 | 2125305..2125430 (-) | 126 | WP_000799689.1 | competence-stimulating peptide ComC | Regulator |
| OTB22_RS10890 (OTB22_10895) | rlmH | 2125712..2126191 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| OTB22_RS10895 (OTB22_10900) | htrA | 2126374..2127555 (+) | 1182 | WP_000681601.1 | S1C family serine protease | Regulator |
| OTB22_RS10900 (OTB22_10905) | spo0J | 2127613..2128371 (+) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| OTB22_RS10905 (OTB22_10910) | dnaA | 2128584..2129945 (+) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4971.00 Da Isoelectric Point: 11.0775
>NTDB_id=761528 OTB22_RS10880 WP_000799689.1 2125305..2125430(-) (comC/comC1) [Streptococcus pneumoniae strain BC2]
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRLSKFFRDFILQRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=761528 OTB22_RS10880 WP_000799689.1 2125305..2125430(-) (comC/comC1) [Streptococcus pneumoniae strain BC2]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GTTGTCAAAATTCTTCCGTGATTTTATTTTACAAAGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae G54 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae A66 |
80.488 |
100 |
0.805 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis NCTC 12261 |
74.074 |
65.854 |
0.488 |
| comC/blpC | Streptococcus mutans UA159 |
44.444 |
87.805 |
0.39 |