Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | OS912_RS06385 | Genome accession | NZ_CP113266 |
| Coordinates | 1254834..1254959 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain BC1 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1249834..1259959
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS912_RS10965 | - | 1250178..1251775 (-) | 1598 | Protein_1221 | YhgE/Pip family protein | - |
| OS912_RS06360 (OS912_06365) | - | 1251954..1252496 (+) | 543 | WP_001863823.1 | TetR/AcrR family transcriptional regulator | - |
| OS912_RS06375 (OS912_06380) | comE | 1252739..1253491 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| OS912_RS06380 (OS912_06385) | comD/comD2 | 1253488..1254813 (-) | 1326 | WP_000364846.1 | competence system sensor histidine kinase ComD | Regulator |
| OS912_RS06385 (OS912_06390) | comC/comC2 | 1254834..1254959 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| OS912_RS06395 (OS912_06400) | rlmH | 1255241..1255720 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| OS912_RS06400 (OS912_06405) | htrA | 1255903..1257084 (+) | 1182 | WP_000681597.1 | S1C family serine protease | Regulator |
| OS912_RS06405 (OS912_06410) | spo0J | 1257142..1257900 (+) | 759 | WP_000410380.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| OS912_RS06410 (OS912_06415) | dnaA | 1258113..1259474 (+) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=761429 OS912_RS06385 WP_000799686.1 1254834..1254959(-) (comC/comC2) [Streptococcus pneumoniae strain BC1]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=761429 OS912_RS06385 WP_000799686.1 1254834..1254959(-) (comC/comC2) [Streptococcus pneumoniae strain BC1]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |