NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	ORP33_RS17510	Genome accession	NZ_CP113256
Coordinates	3384960..3385553 (+)	Length	197 a.a.
NCBI ID	WP_003228214.1	Uniprot ID	A0A199WEF2
Organism	Bacillus subtilis strain K1
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 3379960..3390553

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ORP33_RS17480 (ORP33_17115)	psmA	3380215..3380550 (+)	336	WP_014480966.1	SMR family transporter	-
ORP33_RS17485 (ORP33_17120)	psmB	3380550..3380870 (+)	321	WP_003228222.1	QacE family quaternary ammonium compound efflux SMR transporter	-
ORP33_RS17490 (ORP33_17125)	yvdQ	3380906..3381418 (-)	513	WP_003243249.1	DUF3231 family protein	-
ORP33_RS17495 (ORP33_17130)	cotNP	3381670..3383013 (-)	1344	WP_029725961.1	FAD-binding oxidoreductase	-
ORP33_RS17500 (ORP33_17135)	cotR	3383369..3384331 (+)	963	WP_029725962.1	sporulation hydrolase CotR	-
ORP33_RS17510 (ORP33_17145)	clpP	3384960..3385553 (+)	594	WP_003228214.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
ORP33_RS17515 (ORP33_17150)	pgmB	3385616..3386290 (-)	675	WP_213414979.1	beta-phosphoglucomutase	-
ORP33_RS17520 (ORP33_17155)	malL	3386287..3387972 (-)	1686	WP_213414980.1	glycoside hydrolase family 13 protein	-
ORP33_RS17525 (ORP33_17160)	mdxK	3387965..3390238 (-)	2274	WP_213414981.1	glycoside hydrolase family 65 protein	-

Sequence

Protein

Download Length: 197 a.a. Molecular weight: 21682.00 Da Isoelectric Point: 4.9416

                                >NTDB_id=761285 ORP33_RS17510 WP_003228214.1 3384960..3385553(+) (clpP) [Bacillus subtilis strain K1]

MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT

MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ

PLEVIERDTDRDNFKSAEEALEYGLIDKILTHTEDKK

Nucleotide

Download Length: 594 bp

                                >NTDB_id=761285 ORP33_RS17510 WP_003228214.1 3384960..3385553(+) (clpP) [Bacillus subtilis strain K1]

ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGGGAAAGAGCGTATGACATTTATTCTCGTCTATTAAAGGA

TCGTATCATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCTTAGCAGCAG

AAGACCCTGAAAAAGAAATTTCTCTTTACATCAACAGCCCGGGCGGCTCTATTACAGCCGGTATGGCGATCTATGATACC

ATGCAGTTTATTAAGCCGAAGGTATCTACAATTTGTATCGGTATGGCTGCGTCAATGGGCGCGTTCCTGCTTGCAGCCGG

CGAAAAAGGCAAACGCTATGCGCTTCCAAACAGTGAAGTCATGATTCACCAGCCTCTTGGCGGTGCGCAAGGTCAGGCGA

CAGAAATTGAAATTGCCGCGAAACGCATTCTCTTGCTTCGCGACAAATTAAACAAAGTCCTTGCTGAACGTACTGGCCAG

CCGCTTGAAGTGATCGAACGCGACACAGACCGTGATAACTTCAAGTCTGCTGAAGAAGCGCTTGAATACGGCCTGATTGA

CAAAATTTTGACTCACACAGAAGACAAAAAGTAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(13-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A199WEF2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	100	100	1
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	68.617	95.431	0.655
clpP	Streptococcus thermophilus LMG 18311	58.163	99.492	0.579
clpP	Streptococcus thermophilus LMD-9	58.163	99.492	0.579
clpP	Streptococcus pneumoniae D39	57.812	97.462	0.563
clpP	Streptococcus pneumoniae Rx1	57.812	97.462	0.563
clpP	Streptococcus pneumoniae R6	57.812	97.462	0.563
clpP	Streptococcus pneumoniae TIGR4	57.812	97.462	0.563
clpP	Lactococcus lactis subsp. cremoris KW2	57.895	96.447	0.558
clpP	Streptococcus pyogenes JRS4	56.122	99.492	0.558
clpP	Streptococcus pyogenes MGAS315	56.122	99.492	0.558
clpP	Streptococcus mutans UA159	54.822	100	0.548
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	55.789	96.447	0.538

Detailed information NTG0761285