Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | N7J25_RS03350 | Genome accession | NZ_CP104750 |
| Coordinates | 591151..591330 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae strain TAH 10/84 dMrvR | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 548843..591933 | 591151..591330 | within | 0 |
Gene organization within MGE regions
Location: 548843..591933
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7J25_RS03060 (N7J25_03060) | - | 548861..549700 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| N7J25_RS03065 (N7J25_03065) | - | 549675..550277 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| N7J25_RS03070 (N7J25_03070) | - | 550380..550655 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| N7J25_RS03075 (N7J25_03075) | - | 550743..551885 (-) | 1143 | WP_000269474.1 | site-specific integrase | - |
| N7J25_RS03080 (N7J25_03080) | - | 552000..552551 (-) | 552 | WP_000353929.1 | hypothetical protein | - |
| N7J25_RS03085 (N7J25_03085) | - | 552569..552955 (-) | 387 | WP_000151183.1 | ImmA/IrrE family metallo-endopeptidase | - |
| N7J25_RS03090 (N7J25_03090) | - | 552959..553306 (-) | 348 | WP_000493080.1 | helix-turn-helix domain-containing protein | - |
| N7J25_RS03095 (N7J25_03095) | - | 553603..553848 (+) | 246 | WP_000739595.1 | hypothetical protein | - |
| N7J25_RS03100 (N7J25_03100) | - | 553799..554587 (-) | 789 | WP_000092751.1 | hypothetical protein | - |
| N7J25_RS03105 (N7J25_03105) | - | 554638..554829 (+) | 192 | WP_001112862.1 | hypothetical protein | - |
| N7J25_RS03110 (N7J25_03110) | - | 554909..555220 (+) | 312 | WP_001123483.1 | hypothetical protein | - |
| N7J25_RS03115 (N7J25_03115) | - | 555225..555374 (+) | 150 | WP_000732608.1 | hypothetical protein | - |
| N7J25_RS03120 (N7J25_03120) | - | 555368..555595 (+) | 228 | WP_000910901.1 | hypothetical protein | - |
| N7J25_RS03125 (N7J25_03125) | - | 555588..555818 (+) | 231 | WP_000573548.1 | hypothetical protein | - |
| N7J25_RS03130 (N7J25_03130) | - | 555802..557121 (+) | 1320 | WP_000156423.1 | AAA family ATPase | - |
| N7J25_RS03135 (N7J25_03135) | - | 557136..558230 (+) | 1095 | WP_001167562.1 | ATP-binding protein | - |
| N7J25_RS03140 (N7J25_03140) | - | 558270..558692 (+) | 423 | WP_000361801.1 | hypothetical protein | - |
| N7J25_RS03145 (N7J25_03145) | - | 558694..559428 (+) | 735 | WP_001293486.1 | hypothetical protein | - |
| N7J25_RS03150 (N7J25_03150) | - | 559449..560054 (+) | 606 | WP_038406062.1 | hypothetical protein | - |
| N7J25_RS03155 (N7J25_03155) | - | 560054..560662 (+) | 609 | WP_001876771.1 | hypothetical protein | - |
| N7J25_RS03160 (N7J25_03160) | - | 560668..562251 (+) | 1584 | WP_032457631.1 | DEAD/DEAH box helicase | - |
| N7J25_RS03165 (N7J25_03165) | - | 562260..562457 (+) | 198 | WP_000427885.1 | hypothetical protein | - |
| N7J25_RS03170 (N7J25_03170) | - | 562450..562701 (-) | 252 | WP_001114109.1 | hypothetical protein | - |
| N7J25_RS03175 (N7J25_03175) | - | 562772..565051 (+) | 2280 | WP_000829573.1 | AAA family ATPase | - |
| N7J25_RS03180 (N7J25_03180) | - | 565413..565631 (+) | 219 | WP_000388746.1 | hypothetical protein | - |
| N7J25_RS03185 (N7J25_03185) | - | 565624..566019 (+) | 396 | WP_000569002.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N7J25_RS03190 (N7J25_03190) | - | 566016..566231 (+) | 216 | WP_000687319.1 | hypothetical protein | - |
| N7J25_RS03195 (N7J25_03195) | - | 566228..566464 (+) | 237 | WP_000145465.1 | DUF3310 domain-containing protein | - |
| N7J25_RS03200 (N7J25_03200) | - | 566461..566694 (+) | 234 | WP_001005354.1 | hypothetical protein | - |
| N7J25_RS03205 (N7J25_03205) | - | 566771..567184 (+) | 414 | WP_000041037.1 | transcriptional regulator | - |
| N7J25_RS03210 (N7J25_03210) | - | 567359..568111 (+) | 753 | WP_001075092.1 | toll/interleukin-1 receptor domain-containing protein | - |
| N7J25_RS03215 (N7J25_03215) | - | 568165..568596 (+) | 432 | WP_038406064.1 | terminase small subunit | - |
| N7J25_RS03220 (N7J25_03220) | - | 568586..569866 (+) | 1281 | WP_000208744.1 | PBSX family phage terminase large subunit | - |
| N7J25_RS03225 (N7J25_03225) | - | 569944..571410 (+) | 1467 | WP_374188409.1 | phage portal protein | - |
| N7J25_RS03230 (N7J25_03230) | - | 571370..572818 (+) | 1449 | WP_032457629.1 | phage head morphogenesis protein | - |
| N7J25_RS10250 | - | 572846..573034 (+) | 189 | WP_025194292.1 | hypothetical protein | - |
| N7J25_RS03235 (N7J25_03235) | - | 573039..573242 (+) | 204 | WP_001042286.1 | hypothetical protein | - |
| N7J25_RS03240 (N7J25_03240) | - | 573385..573954 (+) | 570 | WP_000797011.1 | DUF4355 domain-containing protein | - |
| N7J25_RS03245 (N7J25_03245) | - | 573973..574869 (+) | 897 | WP_000818573.1 | hypothetical protein | - |
| N7J25_RS03250 (N7J25_03250) | - | 574875..575231 (+) | 357 | WP_000356704.1 | phage head-tail connector protein | - |
| N7J25_RS03255 (N7J25_03255) | - | 575242..575520 (+) | 279 | WP_000639436.1 | hypothetical protein | - |
| N7J25_RS03260 (N7J25_03260) | - | 575517..575861 (+) | 345 | WP_000060407.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| N7J25_RS03265 (N7J25_03265) | - | 575869..576228 (+) | 360 | WP_000331817.1 | hypothetical protein | - |
| N7J25_RS03270 (N7J25_03270) | - | 576240..576872 (+) | 633 | WP_000450518.1 | phage major tail protein, TP901-1 family | - |
| N7J25_RS03275 (N7J25_03275) | - | 576923..577378 (+) | 456 | WP_000424191.1 | tail assembly chaperone | - |
| N7J25_RS03280 (N7J25_03280) | - | 577453..577683 (+) | 231 | WP_000398752.1 | hypothetical protein | - |
| N7J25_RS03285 (N7J25_03285) | - | 577712..581938 (+) | 4227 | WP_000929199.1 | tape measure protein | - |
| N7J25_RS03290 (N7J25_03290) | - | 581951..582793 (+) | 843 | WP_000365119.1 | phage tail domain-containing protein | - |
| N7J25_RS03295 (N7J25_03295) | - | 582806..586633 (+) | 3828 | WP_000206521.1 | phage tail protein | - |
| N7J25_RS03300 (N7J25_03300) | - | 586642..586794 (+) | 153 | WP_000391486.1 | hypothetical protein | - |
| N7J25_RS03305 (N7J25_03305) | - | 586805..587221 (+) | 417 | WP_001870768.1 | DUF1366 domain-containing protein | - |
| N7J25_RS03310 (N7J25_03310) | - | 587284..587445 (+) | 162 | WP_000222555.1 | hypothetical protein | - |
| N7J25_RS03315 (N7J25_03315) | - | 587455..587745 (+) | 291 | WP_000564986.1 | hypothetical protein | - |
| N7J25_RS03320 (N7J25_03320) | - | 587747..587998 (+) | 252 | WP_000611525.1 | phage holin | - |
| N7J25_RS03325 (N7J25_03325) | - | 588118..589311 (+) | 1194 | WP_000143381.1 | glucosaminidase domain-containing protein | - |
| N7J25_RS03330 (N7J25_03330) | - | 589677..590192 (+) | 516 | WP_000837684.1 | hypothetical protein | - |
| N7J25_RS03335 (N7J25_03335) | - | 590320..590520 (+) | 201 | WP_000076712.1 | CsbD family protein | - |
| N7J25_RS03340 (N7J25_03340) | - | 590561..590731 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| N7J25_RS03345 (N7J25_03345) | - | 590867..590992 (-) | 126 | WP_017646884.1 | hypothetical protein | - |
| N7J25_RS03350 (N7J25_03350) | prx | 591151..591330 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
| N7J25_RS03355 (N7J25_03355) | - | 591736..591933 (+) | 198 | WP_001290370.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=731911 N7J25_RS03350 WP_000965651.1 591151..591330(+) (prx) [Streptococcus agalactiae strain TAH 10/84 dMrvR]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=731911 N7J25_RS03350 WP_000965651.1 591151..591330(+) (prx) [Streptococcus agalactiae strain TAH 10/84 dMrvR]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |