Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | N7J24_RS03355 | Genome accession | NZ_CP104749 |
| Coordinates | 591117..591296 (+) | Length | 59 a.a. |
| NCBI ID | WP_000965651.1 | Uniprot ID | A0AB38VMU0 |
| Organism | Streptococcus agalactiae strain TAH 10/84 dUdp | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 548809..592875 | 591117..591296 | within | 0 |
Gene organization within MGE regions
Location: 548809..592875
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7J24_RS03065 (N7J24_03065) | - | 548827..549666 (+) | 840 | WP_001035227.1 | SGNH/GDSL hydrolase family protein | - |
| N7J24_RS03070 (N7J24_03070) | - | 549641..550243 (+) | 603 | WP_000806954.1 | YpmS family protein | - |
| N7J24_RS03075 (N7J24_03075) | - | 550346..550621 (+) | 276 | WP_001284634.1 | HU family DNA-binding protein | - |
| N7J24_RS03080 (N7J24_03080) | - | 550709..551851 (-) | 1143 | WP_000269474.1 | site-specific integrase | - |
| N7J24_RS03085 (N7J24_03085) | - | 551966..552517 (-) | 552 | WP_000353929.1 | hypothetical protein | - |
| N7J24_RS03090 (N7J24_03090) | - | 552535..552921 (-) | 387 | WP_000151183.1 | ImmA/IrrE family metallo-endopeptidase | - |
| N7J24_RS03095 (N7J24_03095) | - | 552925..553272 (-) | 348 | WP_000493080.1 | helix-turn-helix domain-containing protein | - |
| N7J24_RS03100 (N7J24_03100) | - | 553569..553814 (+) | 246 | WP_000739595.1 | hypothetical protein | - |
| N7J24_RS03105 (N7J24_03105) | - | 553765..554553 (-) | 789 | WP_000092751.1 | hypothetical protein | - |
| N7J24_RS03110 (N7J24_03110) | - | 554604..554795 (+) | 192 | WP_001112862.1 | hypothetical protein | - |
| N7J24_RS03115 (N7J24_03115) | - | 554875..555186 (+) | 312 | WP_001123483.1 | hypothetical protein | - |
| N7J24_RS03120 (N7J24_03120) | - | 555191..555340 (+) | 150 | WP_000732608.1 | hypothetical protein | - |
| N7J24_RS03125 (N7J24_03125) | - | 555334..555561 (+) | 228 | WP_000910901.1 | hypothetical protein | - |
| N7J24_RS03130 (N7J24_03130) | - | 555554..555784 (+) | 231 | WP_000573548.1 | hypothetical protein | - |
| N7J24_RS03135 (N7J24_03135) | - | 555768..557087 (+) | 1320 | WP_000156423.1 | AAA family ATPase | - |
| N7J24_RS03140 (N7J24_03140) | - | 557102..558196 (+) | 1095 | WP_001167562.1 | ATP-binding protein | - |
| N7J24_RS03145 (N7J24_03145) | - | 558236..558658 (+) | 423 | WP_000361801.1 | hypothetical protein | - |
| N7J24_RS03150 (N7J24_03150) | - | 558660..559394 (+) | 735 | WP_001293486.1 | hypothetical protein | - |
| N7J24_RS03155 (N7J24_03155) | - | 559415..560020 (+) | 606 | WP_038406062.1 | hypothetical protein | - |
| N7J24_RS03160 (N7J24_03160) | - | 560020..560628 (+) | 609 | WP_001876771.1 | hypothetical protein | - |
| N7J24_RS03165 (N7J24_03165) | - | 560634..562217 (+) | 1584 | WP_032457631.1 | DEAD/DEAH box helicase | - |
| N7J24_RS03170 (N7J24_03170) | - | 562226..562423 (+) | 198 | WP_000427885.1 | hypothetical protein | - |
| N7J24_RS03175 (N7J24_03175) | - | 562416..562667 (-) | 252 | WP_001114109.1 | hypothetical protein | - |
| N7J24_RS03180 (N7J24_03180) | - | 562738..565017 (+) | 2280 | WP_000829573.1 | AAA family ATPase | - |
| N7J24_RS03185 (N7J24_03185) | - | 565379..565597 (+) | 219 | WP_000388746.1 | hypothetical protein | - |
| N7J24_RS03190 (N7J24_03190) | - | 565590..565985 (+) | 396 | WP_000569002.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N7J24_RS03195 (N7J24_03195) | - | 565982..566197 (+) | 216 | WP_000687319.1 | hypothetical protein | - |
| N7J24_RS03200 (N7J24_03200) | - | 566194..566430 (+) | 237 | WP_000145465.1 | DUF3310 domain-containing protein | - |
| N7J24_RS03205 (N7J24_03205) | - | 566427..566660 (+) | 234 | WP_001005354.1 | hypothetical protein | - |
| N7J24_RS03210 (N7J24_03210) | - | 566737..567150 (+) | 414 | WP_000041037.1 | transcriptional regulator | - |
| N7J24_RS03215 (N7J24_03215) | - | 567325..568077 (+) | 753 | WP_001075092.1 | toll/interleukin-1 receptor domain-containing protein | - |
| N7J24_RS03220 (N7J24_03220) | - | 568131..568562 (+) | 432 | WP_038406064.1 | terminase small subunit | - |
| N7J24_RS03225 (N7J24_03225) | - | 568552..569832 (+) | 1281 | WP_000208744.1 | PBSX family phage terminase large subunit | - |
| N7J24_RS03230 (N7J24_03230) | - | 569910..571376 (+) | 1467 | WP_374188409.1 | phage portal protein | - |
| N7J24_RS03235 (N7J24_03235) | - | 571336..572784 (+) | 1449 | WP_032457629.1 | phage head morphogenesis protein | - |
| N7J24_RS10255 | - | 572812..573000 (+) | 189 | WP_025194292.1 | hypothetical protein | - |
| N7J24_RS03240 (N7J24_03240) | - | 573005..573208 (+) | 204 | WP_001042286.1 | hypothetical protein | - |
| N7J24_RS03245 (N7J24_03245) | - | 573351..573920 (+) | 570 | WP_000797011.1 | DUF4355 domain-containing protein | - |
| N7J24_RS03250 (N7J24_03250) | - | 573939..574835 (+) | 897 | WP_000818573.1 | hypothetical protein | - |
| N7J24_RS03255 (N7J24_03255) | - | 574841..575197 (+) | 357 | WP_000356704.1 | phage head-tail connector protein | - |
| N7J24_RS03260 (N7J24_03260) | - | 575208..575486 (+) | 279 | WP_000639436.1 | hypothetical protein | - |
| N7J24_RS03265 (N7J24_03265) | - | 575483..575827 (+) | 345 | WP_000060407.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| N7J24_RS03270 (N7J24_03270) | - | 575835..576194 (+) | 360 | WP_000331817.1 | hypothetical protein | - |
| N7J24_RS03275 (N7J24_03275) | - | 576206..576838 (+) | 633 | WP_000450518.1 | phage major tail protein, TP901-1 family | - |
| N7J24_RS03280 (N7J24_03280) | - | 576889..577344 (+) | 456 | WP_000424191.1 | tail assembly chaperone | - |
| N7J24_RS03285 (N7J24_03285) | - | 577419..577649 (+) | 231 | WP_000398752.1 | hypothetical protein | - |
| N7J24_RS03290 (N7J24_03290) | - | 577678..581904 (+) | 4227 | WP_000929199.1 | tape measure protein | - |
| N7J24_RS03295 (N7J24_03295) | - | 581917..582759 (+) | 843 | WP_000365119.1 | phage tail domain-containing protein | - |
| N7J24_RS03300 (N7J24_03300) | - | 582772..586599 (+) | 3828 | WP_000206521.1 | phage tail protein | - |
| N7J24_RS03305 (N7J24_03305) | - | 586608..586760 (+) | 153 | WP_000391486.1 | hypothetical protein | - |
| N7J24_RS03310 (N7J24_03310) | - | 586771..587187 (+) | 417 | WP_001870768.1 | DUF1366 domain-containing protein | - |
| N7J24_RS03315 (N7J24_03315) | - | 587250..587411 (+) | 162 | WP_000222555.1 | hypothetical protein | - |
| N7J24_RS03320 (N7J24_03320) | - | 587421..587711 (+) | 291 | WP_000564986.1 | hypothetical protein | - |
| N7J24_RS03325 (N7J24_03325) | - | 587713..587964 (+) | 252 | WP_000611525.1 | phage holin | - |
| N7J24_RS03330 (N7J24_03330) | - | 588084..589277 (+) | 1194 | WP_000143381.1 | glucosaminidase domain-containing protein | - |
| N7J24_RS03335 (N7J24_03335) | - | 589643..590158 (+) | 516 | WP_000837684.1 | hypothetical protein | - |
| N7J24_RS03340 (N7J24_03340) | - | 590286..590486 (+) | 201 | WP_000076712.1 | CsbD family protein | - |
| N7J24_RS03345 (N7J24_03345) | - | 590527..590697 (-) | 171 | WP_000356856.1 | hypothetical protein | - |
| N7J24_RS03350 (N7J24_03350) | - | 590833..590958 (-) | 126 | WP_017646884.1 | hypothetical protein | - |
| N7J24_RS03355 (N7J24_03355) | prx | 591117..591296 (+) | 180 | WP_000965651.1 | hypothetical protein | Regulator |
| N7J24_RS03360 (N7J24_03360) | - | 591702..591899 (+) | 198 | WP_001290370.1 | hypothetical protein | - |
| N7J24_RS03365 (N7J24_03365) | - | 591943..592875 (-) | 933 | WP_000254064.1 | dihydroorotate oxidase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 7035.07 Da Isoelectric Point: 4.3690
>NTDB_id=731858 N7J24_RS03355 WP_000965651.1 591117..591296(+) (prx) [Streptococcus agalactiae strain TAH 10/84 dUdp]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPHEKVREEEVVTVERVEDVMRELE
Nucleotide
Download Length: 180 bp
>NTDB_id=731858 N7J24_RS03355 WP_000965651.1 591117..591296(+) (prx) [Streptococcus agalactiae strain TAH 10/84 dUdp]
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
ATGTTATACATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGAAGAAGAGGTTGTGACAGTTGAGAGAGTGGAAGATG
TTATGAGAGAATTGGAGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
65.517 |
98.305 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
72.881 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
71.186 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
69.767 |
72.881 |
0.508 |