Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | N7J23_RS03600 | Genome accession | NZ_CP104748 |
| Coordinates | 641006..641194 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain TAH 10/84 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 632219..640964 | 641006..641194 | flank | 42 |
| IS/Tn | 639939..640550 | 641006..641194 | flank | 456 |
Gene organization within MGE regions
Location: 632219..641194
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7J23_RS03560 (N7J23_03560) | - | 633598..633759 (-) | 162 | WP_000508795.1 | TM2 domain-containing protein | - |
| N7J23_RS03565 (N7J23_03565) | - | 634502..635779 (+) | 1278 | WP_000594360.1 | ABC transporter permease | - |
| N7J23_RS03570 (N7J23_03570) | - | 635789..636445 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| N7J23_RS03575 (N7J23_03575) | - | 636445..637821 (+) | 1377 | WP_000594351.1 | ABC transporter permease | - |
| N7J23_RS03580 (N7J23_03580) | - | 637918..638571 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| N7J23_RS03585 (N7J23_03585) | - | 638568..639887 (+) | 1320 | WP_000734169.1 | HAMP domain-containing sensor histidine kinase | - |
| N7J23_RS03590 (N7J23_03590) | - | 639939..640586 (-) | 648 | Protein_626 | IS3 family transposase | - |
| N7J23_RS03595 (N7J23_03595) | - | 640764..640964 (+) | 201 | WP_000076708.1 | CsbD family protein | - |
| N7J23_RS03600 (N7J23_03600) | prx | 641006..641194 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=731807 N7J23_RS03600 WP_000027835.1 641006..641194(+) (prx) [Streptococcus agalactiae strain TAH 10/84]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=731807 N7J23_RS03600 WP_000027835.1 641006..641194(+) (prx) [Streptococcus agalactiae strain TAH 10/84]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |