Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | C11O2_RS05085 | Genome accession | NZ_AP019548 |
| Coordinates | 982817..983005 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 10-85 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 975233..993800 | 982817..983005 | within | 0 |
Gene organization within MGE regions
Location: 975233..993800
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C11O2_RS05050 (A85_09130) | pfkA | 975233..976246 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| C11O2_RS05055 (A85_09140) | - | 976326..979436 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| C11O2_RS05060 (A85_09150) | - | 979621..979992 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| C11O2_RS05065 (A85_09160) | - | 979992..980690 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| C11O2_RS05070 (A85_09170) | - | 980700..981485 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| C11O2_RS05075 (A85_09180) | - | 981612..982226 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| C11O2_RS05085 (A85_09190) | prx | 982817..983005 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| C11O2_RS05090 (A85_09200) | speA | 983225..983980 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| C11O2_RS05095 (A85_09210) | - | 984102..984761 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| C11O2_RS05100 (A85_09220) | - | 984761..984982 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| C11O2_RS05105 (A85_09230) | - | 984992..985765 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| C11O2_RS05110 (A85_09240) | - | 985776..986378 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| C11O2_RS05115 (A85_09250) | - | 986390..987154 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| C11O2_RS05120 (A85_09260) | - | 987480..987689 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| C11O2_RS05125 (A85_09270) | - | 987799..987999 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| C11O2_RS05130 (A85_09280) | - | 988073..988459 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| C11O2_RS05135 (A85_09290) | - | 988448..988657 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| C11O2_RS05140 (A85_09300) | - | 988711..989310 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| C11O2_RS05145 (A85_09310) | - | 989340..989498 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| C11O2_RS05150 (A85_09320) | - | 989855..990679 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| C11O2_RS05155 (A85_09330) | - | 990715..991608 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| C11O2_RS05160 (A85_09340) | - | 991729..992817 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| C11O2_RS05165 (A85_09350) | - | 993180..993800 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=72883 C11O2_RS05085 WP_011285559.1 982817..983005(-) (prx) [Streptococcus pyogenes strain 10-85]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=72883 C11O2_RS05085 WP_011285559.1 982817..983005(-) (prx) [Streptococcus pyogenes strain 10-85]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |