Detailed information NTG0726020

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: NY025_RS22790
• Genome accession: NZ_CP103852
• Coordinates: 3208461..3208967 (-)
• Length: 168 a.a.
• NCBI ID: WP_193026451.1
• Uniprot ID: -
• Organism: Ralstonia pseudosolanacearum strain LMG 9673
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3199102..3209761	3208461..3208967	within	0

Gene organization within MGE regions

Location: 3199102..3209761

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NY025_RS26005	-	3199345..3199635 (-)	291	Protein_2922	transposase	-
NY025_RS22745 (NY025_22745)	-	3199868..3200797 (+)	930	WP_020749589.1	branched-chain amino acid transaminase	-
NY025_RS22750 (NY025_22750)	-	3200822..3201019 (+)	198	WP_011000524.1	zinc-finger domain-containing protein	-
NY025_RS22755 (NY025_22755)	waaF	3201069..3202094 (+)	1026	WP_020749591.1	lipopolysaccharide heptosyltransferase II	-
NY025_RS22760 (NY025_22760)	-	3202134..3202574 (+)	441	WP_003278969.1	nuclear transport factor 2 family protein	-
NY025_RS22765 (NY025_22765)	-	3202614..3203729 (+)	1116	WP_197366210.1	YheT family hydrolase	-
NY025_RS22770 (NY025_22770)	-	3203722..3204309 (+)	588	WP_197366211.1	DUF2946 family protein	-
NY025_RS22775 (NY025_22775)	-	3204324..3206012 (-)	1689	WP_193026449.1	M48 family metallopeptidase	-
NY025_RS22780 (NY025_22780)	moaC	3206106..3206582 (+)	477	WP_193026450.1	cyclic pyranopterin monophosphate synthase MoaC	-
NY025_RS22785 (NY025_22785)	-	3206654..3208387 (-)	1734	WP_193028552.1	PglL family O-oligosaccharyltransferase	-
NY025_RS22790 (NY025_22790)	pilA	3208461..3208967 (-)	507	WP_193026451.1	pilin	Machinery gene
NY025_RS22795 (NY025_22795)	pilA	3209240..3209761 (-)	522	WP_193026452.1	pilin	Machinery gene

Sequence

Protein

• Length: 168 a.a.
• Molecular weight: 16971.66 Da
• Isoelectric Point: 9.9490

>NTDB_id=726020 NY025_RS22790 WP_193026451.1 3208461..3208967(-) (pilA) [Ralstonia pseudosolanacearum strain LMG 9673]
MKSMRLNKRVQKGFTLIELMIVVAIVGILAAIAIPAYQDYTVRARVTEGLSLAAQAKALVSENAANAQTDLSVGSSVFTP
TKNVANLAIDGTTAGVPGQITVTYTTAAGGGTLALVPTAAGAKLPTGSAPSGPIMWTCYAAGKATAASSVNPNATMTLAA
KYAPAECR

Nucleotide

• Length: 507 bp

>NTDB_id=726020 NY025_RS22790 WP_193026451.1 3208461..3208967(-) (pilA) [Ralstonia pseudosolanacearum strain LMG 9673]
ATGAAGTCGATGCGTCTCAACAAGCGTGTCCAAAAGGGTTTCACGCTGATCGAACTGATGATCGTGGTCGCGATCGTCGG
TATTCTGGCTGCGATTGCCATTCCGGCCTATCAGGACTACACGGTTCGTGCACGCGTGACGGAAGGCCTGTCGCTGGCTG
CGCAAGCCAAGGCACTGGTGTCGGAAAACGCTGCCAATGCACAAACTGACCTGTCGGTAGGTTCGTCGGTGTTCACGCCC
ACCAAGAACGTTGCAAACCTTGCAATTGATGGCACTACGGCTGGTGTTCCGGGCCAGATCACCGTGACCTATACGACGGC
AGCCGGCGGCGGCACGCTGGCTCTGGTCCCGACCGCGGCAGGCGCTAAGCTGCCGACGGGTTCGGCTCCGTCGGGTCCGA
TCATGTGGACCTGCTACGCTGCGGGTAAGGCTACGGCCGCCAGCAGCGTTAATCCGAACGCTACGATGACGCTGGCAGCG
AAGTATGCTCCGGCAGAATGCCGCTAA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (42-168)

• Prokaryotic N-terminal methylation motif (N_methyl) (9-33)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Ralstonia pseudosolanacearum GMI1000	89.349	100	0.899
pilA2	Legionella pneumophila str. Paris	51.235	96.429	0.494
pilA2	Legionella pneumophila strain ERS1305867	50.617	96.429	0.488
comP	Acinetobacter baylyi ADP1	44.97	100	0.452
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	38.462	100	0.446
pilA/pilA1	Eikenella corrodens VA1	41.176	91.071	0.375
pilA/pilAI	Pseudomonas stutzeri DSM 10701	34.659	100	0.363