Detailed information NTG0719034

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: NWO26_RS06435
• Genome accession: NZ_CP102797
• Coordinates: 1263199..1263627 (-)
• Length: 142 a.a.
• NCBI ID: WP_011226626.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain ST057-1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1258199..1268627

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NWO26_RS06390	-	1258335..1258778 (-)	444	WP_113870473.1	CAAX protease	-
NWO26_RS06395	-	1258852..1259190 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
NWO26_RS06400	-	1259234..1259509 (-)	276	WP_011681681.1	hypothetical protein	-
NWO26_RS06405	-	1259521..1259719 (-)	199	Protein_1263	helix-turn-helix transcriptional regulator	-
NWO26_RS06410	-	1259968..1261161 (-)	1194	WP_014608740.1	acetate kinase	-
NWO26_RS06415	comYH	1261217..1262173 (-)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
NWO26_RS06420	comGG	1262218..1262535 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	-
NWO26_RS06425	comYF	1262513..1262950 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
NWO26_RS06430	comGE	1262934..1263227 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
NWO26_RS06435	comYD	1263199..1263627 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
NWO26_RS06440	comYC	1263587..1263913 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
NWO26_RS06445	comYB	1263910..1265010 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
NWO26_RS06450	comGA/cglA/cilD	1264892..1265833 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
NWO26_RS06455	-	1265914..1266276 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15859.45 Da
• Isoelectric Point: 10.3330

>NTDB_id=719034 NWO26_RS06435 WP_011226626.1 1263199..1263627(-) (comYD) [Streptococcus thermophilus strain ST057-1]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVSNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=719034 NWO26_RS06435 WP_011226626.1 1263199..1263627(-) (comYD) [Streptococcus thermophilus strain ST057-1]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTTAGTAATGGAAGGTCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGAGGCAACTCGAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	52.672	92.254	0.486
comYD	Streptococcus mutans UA159	52.672	92.254	0.486
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae D39	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae R6	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis NCTC 12261	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis SK321	43.307	89.437	0.387
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38