Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   NQD65_RS02480 Genome accession   NZ_CP101996
Coordinates   427163..427342 (+) Length   59 a.a.
NCBI ID   WP_017647274.1    Uniprot ID   A0A853P545
Organism   Streptococcus agalactiae strain BCJB1835     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 384106..441844 427163..427342 within 0


Gene organization within MGE regions


Location: 384106..441844
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NQD65_RS02230 (NQD65_02235) - 384106..385185 (-) 1080 WP_050150017.1 site-specific integrase -
  NQD65_RS02235 (NQD65_02240) - 385593..386666 (-) 1074 WP_017647292.1 hypothetical protein -
  NQD65_RS02240 (NQD65_02245) - 386679..387065 (-) 387 WP_000151181.1 ImmA/IrrE family metallo-endopeptidase -
  NQD65_RS02245 (NQD65_02250) - 387069..387416 (-) 348 WP_000484484.1 helix-turn-helix transcriptional regulator -
  NQD65_RS02250 (NQD65_02255) - 388169..388360 (+) 192 WP_001283052.1 hypothetical protein -
  NQD65_RS02255 (NQD65_02260) - 388371..389171 (+) 801 WP_017647291.1 phage antirepressor KilAC domain-containing protein -
  NQD65_RS02260 (NQD65_02265) - 389232..389513 (+) 282 WP_017647290.1 hypothetical protein -
  NQD65_RS02265 (NQD65_02270) - 389515..389685 (+) 171 WP_017647289.1 hypothetical protein -
  NQD65_RS02270 (NQD65_02275) - 389678..389884 (+) 207 WP_017647288.1 hypothetical protein -
  NQD65_RS02275 (NQD65_02280) - 389881..390264 (+) 384 WP_017647287.1 hypothetical protein -
  NQD65_RS02280 (NQD65_02285) - 390411..390614 (+) 204 WP_002983407.1 hypothetical protein -
  NQD65_RS02285 (NQD65_02290) - 390702..391001 (+) 300 WP_002988708.1 hypothetical protein -
  NQD65_RS02290 (NQD65_02295) - 391001..392155 (+) 1155 WP_050150018.1 DUF2800 domain-containing protein -
  NQD65_RS02295 (NQD65_02300) - 392159..392557 (+) 399 WP_002988715.1 hypothetical protein -
  NQD65_RS02300 (NQD65_02305) - 392568..393125 (+) 558 WP_017647284.1 DUF2815 family protein -
  NQD65_RS02305 (NQD65_02310) - 393168..395090 (+) 1923 WP_017647283.1 DNA polymerase -
  NQD65_RS02310 (NQD65_02315) - 395095..397479 (+) 2385 WP_050150019.1 phage/plasmid primase, P4 family -
  NQD65_RS02315 (NQD65_02320) - 397866..398141 (+) 276 WP_001258483.1 VRR-NUC domain-containing protein -
  NQD65_RS02320 (NQD65_02325) - 398138..399460 (+) 1323 WP_001236565.1 SNF2-related protein -
  NQD65_RS02325 (NQD65_02330) - 399627..399893 (+) 267 WP_017647282.1 hypothetical protein -
  NQD65_RS02330 (NQD65_02335) - 399897..400382 (+) 486 WP_017647281.1 class I SAM-dependent methyltransferase -
  NQD65_RS02335 (NQD65_02340) - 400476..401039 (+) 564 WP_017647280.1 DUF1642 domain-containing protein -
  NQD65_RS02340 (NQD65_02345) - 401036..401302 (+) 267 WP_000660740.1 hypothetical protein -
  NQD65_RS02345 (NQD65_02350) - 401692..402117 (+) 426 WP_000533373.1 DUF1492 domain-containing protein -
  NQD65_RS02350 (NQD65_02355) - 402692..403012 (+) 321 WP_000033707.1 hypothetical protein -
  NQD65_RS02355 (NQD65_02360) - 403075..403329 (+) 255 WP_000802599.1 hypothetical protein -
  NQD65_RS02360 (NQD65_02365) - 403326..403643 (+) 318 WP_000582684.1 HNH endonuclease -
  NQD65_RS02365 (NQD65_02370) - 403780..404136 (+) 357 WP_000343900.1 hypothetical protein -
  NQD65_RS02370 (NQD65_02375) - 404133..405776 (+) 1644 WP_000628070.1 terminase TerL endonuclease subunit -
  NQD65_RS02375 (NQD65_02380) - 405845..406993 (+) 1149 WP_000696090.1 phage portal protein -
  NQD65_RS02380 (NQD65_02385) - 406974..407705 (+) 732 WP_000192152.1 head maturation protease, ClpP-related -
  NQD65_RS02385 (NQD65_02390) - 407727..408887 (+) 1161 WP_000178057.1 phage major capsid protein -
  NQD65_RS02390 (NQD65_02395) - 408891..409184 (+) 294 WP_000343313.1 head-tail connector protein -
  NQD65_RS02395 (NQD65_02400) - 409156..409305 (+) 150 WP_000868405.1 hypothetical protein -
  NQD65_RS02400 (NQD65_02405) - 409298..409645 (+) 348 WP_000087630.1 hypothetical protein -
  NQD65_RS02405 (NQD65_02410) - 409670..410041 (+) 372 WP_032457488.1 HK97 gp10 family phage protein -
  NQD65_RS02410 (NQD65_02415) - 410034..410414 (+) 381 WP_000237791.1 hypothetical protein -
  NQD65_RS02415 (NQD65_02420) - 410429..411034 (+) 606 WP_001149163.1 major tail protein -
  NQD65_RS02420 (NQD65_02425) gpG 411045..411347 (+) 303 WP_001281299.1 phage tail assembly chaperone G -
  NQD65_RS02425 (NQD65_02430) - 411574..415497 (+) 3924 WP_001051902.1 phage tail tape measure protein -
  NQD65_RS02430 (NQD65_02435) - 415509..417017 (+) 1509 WP_000666985.1 distal tail protein Dit -
  NQD65_RS02435 (NQD65_02440) - 417008..420826 (+) 3819 WP_000260415.1 glucosaminidase domain-containing protein -
  NQD65_RS02440 (NQD65_02445) - 420839..422830 (+) 1992 WP_017647276.1 DUF859 family phage minor structural protein -
  NQD65_RS02445 (NQD65_02450) - 422844..423170 (+) 327 WP_000404432.1 DUF1366 domain-containing protein -
  NQD65_RS02450 (NQD65_02455) - 423145..423357 (+) 213 WP_000698338.1 hypothetical protein -
  NQD65_RS02455 (NQD65_02460) - 423370..423672 (+) 303 WP_000215499.1 hypothetical protein -
  NQD65_RS02460 (NQD65_02465) - 423674..423925 (+) 252 WP_000611525.1 phage holin -
  NQD65_RS02465 (NQD65_02470) - 424055..425398 (+) 1344 WP_000257222.1 GH25 family lysozyme -
  NQD65_RS02470 (NQD65_02475) - 425738..426697 (+) 960 WP_000829578.1 Abi family protein -
  NQD65_RS02475 (NQD65_02480) - 426851..427051 (+) 201 WP_000076696.1 CsbD family protein -
  NQD65_RS02480 (NQD65_02485) prx 427163..427342 (+) 180 WP_017647274.1 hypothetical protein Regulator
  NQD65_RS02485 (NQD65_02490) rimP 427838..428314 (+) 477 WP_041971671.1 ribosome maturation factor RimP -
  NQD65_RS02490 (NQD65_02495) nusA 428350..429501 (+) 1152 WP_000032295.1 transcription termination factor NusA -
  NQD65_RS02495 (NQD65_02500) rnpM 429523..429819 (+) 297 WP_001140526.1 RNase P modulator RnpM -
  NQD65_RS02500 (NQD65_02505) - 429812..430114 (+) 303 WP_001065560.1 YlxQ-related RNA-binding protein -
  NQD65_RS02505 (NQD65_02510) infB 430134..432917 (+) 2784 WP_000039152.1 translation initiation factor IF-2 -
  NQD65_RS02510 (NQD65_02515) rbfA 433026..433376 (+) 351 WP_001273670.1 30S ribosome-binding factor RbfA -
  NQD65_RS02515 (NQD65_02520) - 433460..434464 (-) 1005 WP_000804611.1 alpha/beta hydrolase -
  NQD65_RS02520 (NQD65_02525) - 434628..435044 (+) 417 WP_000156042.1 CopY/TcrY family copper transport repressor -
  NQD65_RS02525 (NQD65_02530) - 435057..437291 (+) 2235 WP_000013400.1 cation-translocating P-type ATPase -
  NQD65_RS02530 (NQD65_02535) - 437332..437538 (+) 207 WP_000683375.1 heavy-metal-associated domain-containing protein -
  NQD65_RS02535 (NQD65_02540) - 437648..438262 (+) 615 WP_000020721.1 trimeric intracellular cation channel family protein -
  NQD65_RS02540 (NQD65_02545) - 438277..439089 (+) 813 WP_000593336.1 Cof-type HAD-IIB family hydrolase -
  NQD65_RS02545 (NQD65_02550) polA 439202..441844 (+) 2643 WP_000182605.1 DNA polymerase I -

Sequence


Protein


Download         Length: 59 a.a.        Molecular weight: 6909.98 Da        Isoelectric Point: 4.0881

>NTDB_id=714007 NQD65_RS02480 WP_017647274.1 427163..427342(+) (prx) [Streptococcus agalactiae strain BCJB1835]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELE

Nucleotide


Download         Length: 180 bp        

>NTDB_id=714007 NQD65_RS02480 WP_017647274.1 427163..427342(+) (prx) [Streptococcus agalactiae strain BCJB1835]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A853P545

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

66.102

100

0.661

  prx Streptococcus pyogenes MGAS8232

67.241

98.305

0.661

  prx Streptococcus pyogenes MGAS315

67.241

98.305

0.661

  prx Streptococcus pyogenes MGAS315

62.712

100

0.627

  prx Streptococcus pyogenes MGAS315

82.927

69.492

0.576

  prx Streptococcus pyogenes MGAS315

73.171

69.492

0.508

  prx Streptococcus pyogenes MGAS315

70.732

69.492

0.492