Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | NQD68_RS02490 | Genome accession | NZ_CP101993 |
| Coordinates | 428024..428203 (+) | Length | 59 a.a. |
| NCBI ID | WP_017647274.1 | Uniprot ID | A0A853P545 |
| Organism | Streptococcus agalactiae strain BCJB3344 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 384967..428203 | 428024..428203 | within | 0 |
Gene organization within MGE regions
Location: 384967..428203
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQD68_RS02240 (NQD68_02245) | - | 384967..386046 (-) | 1080 | WP_050150017.1 | site-specific integrase | - |
| NQD68_RS02245 (NQD68_02250) | - | 386454..387527 (-) | 1074 | WP_017647292.1 | hypothetical protein | - |
| NQD68_RS02250 (NQD68_02255) | - | 387540..387926 (-) | 387 | WP_000151181.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NQD68_RS02255 (NQD68_02260) | - | 387930..388277 (-) | 348 | WP_000484484.1 | helix-turn-helix transcriptional regulator | - |
| NQD68_RS02260 (NQD68_02265) | - | 389030..389221 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| NQD68_RS02265 (NQD68_02270) | - | 389232..390032 (+) | 801 | WP_017647291.1 | phage antirepressor KilAC domain-containing protein | - |
| NQD68_RS02270 (NQD68_02275) | - | 390093..390374 (+) | 282 | WP_017647290.1 | hypothetical protein | - |
| NQD68_RS02275 (NQD68_02280) | - | 390376..390546 (+) | 171 | WP_017647289.1 | hypothetical protein | - |
| NQD68_RS02280 (NQD68_02285) | - | 390539..390745 (+) | 207 | WP_017647288.1 | hypothetical protein | - |
| NQD68_RS02285 (NQD68_02290) | - | 390742..391125 (+) | 384 | WP_017647287.1 | hypothetical protein | - |
| NQD68_RS02290 (NQD68_02295) | - | 391272..391475 (+) | 204 | WP_002983407.1 | hypothetical protein | - |
| NQD68_RS02295 (NQD68_02300) | - | 391563..391862 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| NQD68_RS02300 (NQD68_02305) | - | 391862..393016 (+) | 1155 | WP_050150018.1 | DUF2800 domain-containing protein | - |
| NQD68_RS02305 (NQD68_02310) | - | 393020..393418 (+) | 399 | WP_002988715.1 | hypothetical protein | - |
| NQD68_RS02310 (NQD68_02315) | - | 393429..393986 (+) | 558 | WP_017647284.1 | DUF2815 family protein | - |
| NQD68_RS02315 (NQD68_02320) | - | 394029..395951 (+) | 1923 | WP_017647283.1 | DNA polymerase | - |
| NQD68_RS02320 (NQD68_02325) | - | 395956..398340 (+) | 2385 | WP_309165429.1 | phage/plasmid primase, P4 family | - |
| NQD68_RS02325 (NQD68_02330) | - | 398727..399002 (+) | 276 | WP_001258483.1 | VRR-NUC domain-containing protein | - |
| NQD68_RS02330 (NQD68_02335) | - | 398999..400321 (+) | 1323 | WP_001236565.1 | SNF2-related protein | - |
| NQD68_RS02335 (NQD68_02340) | - | 400488..400754 (+) | 267 | WP_017647282.1 | hypothetical protein | - |
| NQD68_RS02340 (NQD68_02345) | - | 400758..401243 (+) | 486 | WP_017647281.1 | class I SAM-dependent methyltransferase | - |
| NQD68_RS02345 (NQD68_02350) | - | 401337..401900 (+) | 564 | WP_017647280.1 | DUF1642 domain-containing protein | - |
| NQD68_RS02350 (NQD68_02355) | - | 401897..402163 (+) | 267 | WP_000660740.1 | hypothetical protein | - |
| NQD68_RS02355 (NQD68_02360) | - | 402553..402978 (+) | 426 | WP_000533373.1 | DUF1492 domain-containing protein | - |
| NQD68_RS02360 (NQD68_02365) | - | 403553..403873 (+) | 321 | WP_000033707.1 | hypothetical protein | - |
| NQD68_RS02365 (NQD68_02370) | - | 403936..404190 (+) | 255 | WP_000802599.1 | hypothetical protein | - |
| NQD68_RS02370 (NQD68_02375) | - | 404187..404504 (+) | 318 | WP_000582684.1 | HNH endonuclease | - |
| NQD68_RS02375 (NQD68_02380) | - | 404641..404997 (+) | 357 | WP_000343900.1 | hypothetical protein | - |
| NQD68_RS02380 (NQD68_02385) | - | 404994..406637 (+) | 1644 | WP_000628070.1 | terminase TerL endonuclease subunit | - |
| NQD68_RS02385 (NQD68_02390) | - | 406706..407854 (+) | 1149 | WP_000696090.1 | phage portal protein | - |
| NQD68_RS02390 (NQD68_02395) | - | 407835..408566 (+) | 732 | WP_000192152.1 | head maturation protease, ClpP-related | - |
| NQD68_RS02395 (NQD68_02400) | - | 408588..409748 (+) | 1161 | WP_000178057.1 | phage major capsid protein | - |
| NQD68_RS02400 (NQD68_02405) | - | 409752..410045 (+) | 294 | WP_000343313.1 | head-tail connector protein | - |
| NQD68_RS02405 (NQD68_02410) | - | 410017..410166 (+) | 150 | WP_000868405.1 | hypothetical protein | - |
| NQD68_RS02410 (NQD68_02415) | - | 410159..410506 (+) | 348 | WP_000087630.1 | hypothetical protein | - |
| NQD68_RS02415 (NQD68_02420) | - | 410531..410902 (+) | 372 | WP_032457488.1 | HK97 gp10 family phage protein | - |
| NQD68_RS02420 (NQD68_02425) | - | 410895..411275 (+) | 381 | WP_000237791.1 | hypothetical protein | - |
| NQD68_RS02425 (NQD68_02430) | - | 411290..411895 (+) | 606 | WP_001149163.1 | major tail protein | - |
| NQD68_RS02430 (NQD68_02435) | gpG | 411906..412208 (+) | 303 | WP_001281299.1 | phage tail assembly chaperone G | - |
| NQD68_RS02435 (NQD68_02440) | - | 412435..416358 (+) | 3924 | WP_001051902.1 | phage tail tape measure protein | - |
| NQD68_RS02440 (NQD68_02445) | - | 416370..417878 (+) | 1509 | WP_000666985.1 | distal tail protein Dit | - |
| NQD68_RS02445 (NQD68_02450) | - | 417869..421687 (+) | 3819 | WP_000260415.1 | glucosaminidase domain-containing protein | - |
| NQD68_RS02450 (NQD68_02455) | - | 421700..423691 (+) | 1992 | WP_017647276.1 | DUF859 family phage minor structural protein | - |
| NQD68_RS02455 (NQD68_02460) | - | 423705..424031 (+) | 327 | WP_000404432.1 | DUF1366 domain-containing protein | - |
| NQD68_RS02460 (NQD68_02465) | - | 424006..424218 (+) | 213 | WP_000698338.1 | hypothetical protein | - |
| NQD68_RS02465 (NQD68_02470) | - | 424231..424533 (+) | 303 | WP_000215499.1 | hypothetical protein | - |
| NQD68_RS02470 (NQD68_02475) | - | 424535..424786 (+) | 252 | WP_000611525.1 | phage holin | - |
| NQD68_RS02475 (NQD68_02480) | - | 424916..426259 (+) | 1344 | WP_000257222.1 | GH25 family lysozyme | - |
| NQD68_RS02480 (NQD68_02485) | - | 426599..427558 (+) | 960 | WP_000829578.1 | Abi family protein | - |
| NQD68_RS02485 (NQD68_02490) | - | 427712..427912 (+) | 201 | WP_000076696.1 | CsbD family protein | - |
| NQD68_RS02490 (NQD68_02495) | prx | 428024..428203 (+) | 180 | WP_017647274.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6909.98 Da Isoelectric Point: 4.0881
>NTDB_id=713849 NQD68_RS02490 WP_017647274.1 428024..428203(+) (prx) [Streptococcus agalactiae strain BCJB3344]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=713849 NQD68_RS02490 WP_017647274.1 428024..428203(+) (prx) [Streptococcus agalactiae strain BCJB3344]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
62.712 |
100 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
69.492 |
0.576 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
69.492 |
0.492 |