Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | NQD69_RS02480 | Genome accession | NZ_CP101992 |
| Coordinates | 427163..427342 (+) | Length | 59 a.a. |
| NCBI ID | WP_017647274.1 | Uniprot ID | A0A853P545 |
| Organism | Streptococcus agalactiae strain BCJB3586 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 384106..441844 | 427163..427342 | within | 0 |
Gene organization within MGE regions
Location: 384106..441844
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQD69_RS02230 (NQD69_02235) | - | 384106..385185 (-) | 1080 | WP_050150017.1 | site-specific integrase | - |
| NQD69_RS02235 (NQD69_02240) | - | 385593..386666 (-) | 1074 | WP_017647292.1 | hypothetical protein | - |
| NQD69_RS02240 (NQD69_02245) | - | 386679..387065 (-) | 387 | WP_000151181.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NQD69_RS02245 (NQD69_02250) | - | 387069..387416 (-) | 348 | WP_000484484.1 | helix-turn-helix transcriptional regulator | - |
| NQD69_RS02250 (NQD69_02255) | - | 388169..388360 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| NQD69_RS02255 (NQD69_02260) | - | 388371..389171 (+) | 801 | WP_017647291.1 | phage antirepressor KilAC domain-containing protein | - |
| NQD69_RS02260 (NQD69_02265) | - | 389232..389513 (+) | 282 | WP_017647290.1 | hypothetical protein | - |
| NQD69_RS02265 (NQD69_02270) | - | 389515..389685 (+) | 171 | WP_017647289.1 | hypothetical protein | - |
| NQD69_RS02270 (NQD69_02275) | - | 389678..389884 (+) | 207 | WP_017647288.1 | hypothetical protein | - |
| NQD69_RS02275 (NQD69_02280) | - | 389881..390264 (+) | 384 | WP_017647287.1 | hypothetical protein | - |
| NQD69_RS02280 (NQD69_02285) | - | 390411..390614 (+) | 204 | WP_002983407.1 | hypothetical protein | - |
| NQD69_RS02285 (NQD69_02290) | - | 390702..391001 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| NQD69_RS02290 (NQD69_02295) | - | 391001..392155 (+) | 1155 | WP_050150018.1 | DUF2800 domain-containing protein | - |
| NQD69_RS02295 (NQD69_02300) | - | 392159..392557 (+) | 399 | WP_002988715.1 | hypothetical protein | - |
| NQD69_RS02300 (NQD69_02305) | - | 392568..393125 (+) | 558 | WP_017647284.1 | DUF2815 family protein | - |
| NQD69_RS02305 (NQD69_02310) | - | 393168..395090 (+) | 1923 | WP_017647283.1 | DNA polymerase | - |
| NQD69_RS02310 (NQD69_02315) | - | 395095..397479 (+) | 2385 | WP_050150019.1 | phage/plasmid primase, P4 family | - |
| NQD69_RS02315 (NQD69_02320) | - | 397866..398141 (+) | 276 | WP_001258483.1 | VRR-NUC domain-containing protein | - |
| NQD69_RS02320 (NQD69_02325) | - | 398138..399460 (+) | 1323 | WP_001236565.1 | SNF2-related protein | - |
| NQD69_RS02325 (NQD69_02330) | - | 399627..399893 (+) | 267 | WP_017647282.1 | hypothetical protein | - |
| NQD69_RS02330 (NQD69_02335) | - | 399897..400382 (+) | 486 | WP_017647281.1 | class I SAM-dependent methyltransferase | - |
| NQD69_RS02335 (NQD69_02340) | - | 400476..401039 (+) | 564 | WP_017647280.1 | DUF1642 domain-containing protein | - |
| NQD69_RS02340 (NQD69_02345) | - | 401036..401302 (+) | 267 | WP_000660740.1 | hypothetical protein | - |
| NQD69_RS02345 (NQD69_02350) | - | 401692..402117 (+) | 426 | WP_000533373.1 | DUF1492 domain-containing protein | - |
| NQD69_RS02350 (NQD69_02355) | - | 402692..403012 (+) | 321 | WP_000033707.1 | hypothetical protein | - |
| NQD69_RS02355 (NQD69_02360) | - | 403075..403329 (+) | 255 | WP_000802599.1 | hypothetical protein | - |
| NQD69_RS02360 (NQD69_02365) | - | 403326..403643 (+) | 318 | WP_000582684.1 | HNH endonuclease | - |
| NQD69_RS02365 (NQD69_02370) | - | 403780..404136 (+) | 357 | WP_000343900.1 | hypothetical protein | - |
| NQD69_RS02370 (NQD69_02375) | - | 404133..405776 (+) | 1644 | WP_000628070.1 | terminase TerL endonuclease subunit | - |
| NQD69_RS02375 (NQD69_02380) | - | 405845..406993 (+) | 1149 | WP_000696090.1 | phage portal protein | - |
| NQD69_RS02380 (NQD69_02385) | - | 406974..407705 (+) | 732 | WP_000192152.1 | head maturation protease, ClpP-related | - |
| NQD69_RS02385 (NQD69_02390) | - | 407727..408887 (+) | 1161 | WP_000178057.1 | phage major capsid protein | - |
| NQD69_RS02390 (NQD69_02395) | - | 408891..409184 (+) | 294 | WP_000343313.1 | head-tail connector protein | - |
| NQD69_RS02395 (NQD69_02400) | - | 409156..409305 (+) | 150 | WP_000868405.1 | hypothetical protein | - |
| NQD69_RS02400 (NQD69_02405) | - | 409298..409645 (+) | 348 | WP_000087630.1 | hypothetical protein | - |
| NQD69_RS02405 (NQD69_02410) | - | 409670..410041 (+) | 372 | WP_032457488.1 | HK97 gp10 family phage protein | - |
| NQD69_RS02410 (NQD69_02415) | - | 410034..410414 (+) | 381 | WP_000237791.1 | hypothetical protein | - |
| NQD69_RS02415 (NQD69_02420) | - | 410429..411034 (+) | 606 | WP_001149163.1 | major tail protein | - |
| NQD69_RS02420 (NQD69_02425) | gpG | 411045..411347 (+) | 303 | WP_001281299.1 | phage tail assembly chaperone G | - |
| NQD69_RS02425 (NQD69_02430) | - | 411574..415497 (+) | 3924 | WP_001051902.1 | phage tail tape measure protein | - |
| NQD69_RS02430 (NQD69_02435) | - | 415509..417017 (+) | 1509 | WP_000666985.1 | distal tail protein Dit | - |
| NQD69_RS02435 (NQD69_02440) | - | 417008..420826 (+) | 3819 | WP_000260415.1 | glucosaminidase domain-containing protein | - |
| NQD69_RS02440 (NQD69_02445) | - | 420839..422830 (+) | 1992 | WP_017647276.1 | DUF859 family phage minor structural protein | - |
| NQD69_RS02445 (NQD69_02450) | - | 422844..423170 (+) | 327 | WP_000404432.1 | DUF1366 domain-containing protein | - |
| NQD69_RS02450 (NQD69_02455) | - | 423145..423357 (+) | 213 | WP_000698338.1 | hypothetical protein | - |
| NQD69_RS02455 (NQD69_02460) | - | 423370..423672 (+) | 303 | WP_000215499.1 | hypothetical protein | - |
| NQD69_RS02460 (NQD69_02465) | - | 423674..423925 (+) | 252 | WP_000611525.1 | phage holin | - |
| NQD69_RS02465 (NQD69_02470) | - | 424055..425398 (+) | 1344 | WP_000257222.1 | GH25 family lysozyme | - |
| NQD69_RS02470 (NQD69_02475) | - | 425738..426697 (+) | 960 | WP_000829578.1 | Abi family protein | - |
| NQD69_RS02475 (NQD69_02480) | - | 426851..427051 (+) | 201 | WP_000076696.1 | CsbD family protein | - |
| NQD69_RS02480 (NQD69_02485) | prx | 427163..427342 (+) | 180 | WP_017647274.1 | hypothetical protein | Regulator |
| NQD69_RS02485 (NQD69_02490) | rimP | 427838..428314 (+) | 477 | WP_041971671.1 | ribosome maturation factor RimP | - |
| NQD69_RS02490 (NQD69_02495) | nusA | 428350..429501 (+) | 1152 | WP_000032295.1 | transcription termination factor NusA | - |
| NQD69_RS02495 (NQD69_02500) | rnpM | 429523..429819 (+) | 297 | WP_001140526.1 | RNase P modulator RnpM | - |
| NQD69_RS02500 (NQD69_02505) | - | 429812..430114 (+) | 303 | WP_001065560.1 | YlxQ-related RNA-binding protein | - |
| NQD69_RS02505 (NQD69_02510) | infB | 430134..432917 (+) | 2784 | WP_000039152.1 | translation initiation factor IF-2 | - |
| NQD69_RS02510 (NQD69_02515) | rbfA | 433026..433376 (+) | 351 | WP_001273670.1 | 30S ribosome-binding factor RbfA | - |
| NQD69_RS02515 (NQD69_02520) | - | 433460..434464 (-) | 1005 | WP_000804611.1 | alpha/beta hydrolase | - |
| NQD69_RS02520 (NQD69_02525) | - | 434628..435044 (+) | 417 | WP_000156042.1 | CopY/TcrY family copper transport repressor | - |
| NQD69_RS02525 (NQD69_02530) | - | 435057..437291 (+) | 2235 | WP_000013400.1 | cation-translocating P-type ATPase | - |
| NQD69_RS02530 (NQD69_02535) | - | 437332..437538 (+) | 207 | WP_000683375.1 | heavy-metal-associated domain-containing protein | - |
| NQD69_RS02535 (NQD69_02540) | - | 437648..438262 (+) | 615 | WP_000020721.1 | trimeric intracellular cation channel family protein | - |
| NQD69_RS02540 (NQD69_02545) | - | 438277..439089 (+) | 813 | WP_000593336.1 | Cof-type HAD-IIB family hydrolase | - |
| NQD69_RS02545 (NQD69_02550) | polA | 439202..441844 (+) | 2643 | WP_000182605.1 | DNA polymerase I | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6909.98 Da Isoelectric Point: 4.0881
>NTDB_id=713795 NQD69_RS02480 WP_017647274.1 427163..427342(+) (prx) [Streptococcus agalactiae strain BCJB3586]
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELE
MLYIDEFKEAIEKGYISSDTVMVVRKNGKIFDYVLPGEPVRLWEVATEEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=713795 NQD69_RS02480 WP_017647274.1 427163..427342(+) (prx) [Streptococcus agalactiae strain BCJB3586]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGAAAAAGGATATATCAGCAGTGATACAGTGATGGTTGTGCGTAAGAA
CGGAAAGATATTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
66.102 |
100 |
0.661 |
| prx | Streptococcus pyogenes MGAS8232 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
67.241 |
98.305 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
62.712 |
100 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
69.492 |
0.576 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
69.492 |
0.492 |