NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	NP432_RS17470	Genome accession	NZ_CP101931
Coordinates	3398659..3399252 (+)	Length	197 a.a.
NCBI ID	WP_003228214.1	Uniprot ID	A0A199WEF2
Organism	Bacillus subtilis strain BGSC b98af
Function	degradation of ComK; degradation of DegU (predicted from homology) Competence regulation

Genomic Context

Location: 3393659..3404252

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NP432_RS17440 (NP432_17440)	psmA	3393914..3394249 (+)	336	WP_014480966.1	SMR family transporter	-
NP432_RS17445 (NP432_17445)	psmB	3394249..3394569 (+)	321	WP_003228222.1	QacE family quaternary ammonium compound efflux SMR transporter	-
NP432_RS17450 (NP432_17450)	yvdQ	3394605..3395117 (-)	513	WP_003243249.1	DUF3231 family protein	-
NP432_RS17455 (NP432_17455)	cotNP	3395369..3396712 (-)	1344	WP_003228217.1	FAD-binding oxidoreductase	-
NP432_RS17460 (NP432_17460)	cotR	3397068..3398030 (+)	963	WP_015251166.1	sporulation hydrolase CotR	-
NP432_RS17470 (NP432_17470)	clpP	3398659..3399252 (+)	594	WP_003228214.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
NP432_RS17475 (NP432_17475)	pgmB	3399315..3399989 (-)	675	WP_371929812.1	beta-phosphoglucomutase	-
NP432_RS17480 (NP432_17480)	malL	3399986..3401671 (-)	1686	WP_256682998.1	oligo-1,6-glucosidase	-
NP432_RS17485 (NP432_17485)	mdxK	3401664..3403937 (-)	2274	WP_256683503.1	maltose phosphorylase	-

Sequence

Protein

Download Length: 197 a.a. Molecular weight: 21682.00 Da Isoelectric Point: 4.9416

                                >NTDB_id=713108 NP432_RS17470 WP_003228214.1 3398659..3399252(+) (clpP) [Bacillus subtilis strain BGSC b98af]

MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT

MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ

PLEVIERDTDRDNFKSAEEALEYGLIDKILTHTEDKK

Nucleotide

Download Length: 594 bp

                                >NTDB_id=713108 NP432_RS17470 WP_003228214.1 3398659..3399252(+) (clpP) [Bacillus subtilis strain BGSC b98af]

ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGGGAAAGAGCGTATGACATTTATTCTCGTCTATTAAAGGA

TCGTATCATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCTTAGCAGCAG

AAGACCCTGAAAAAGAAATTTCTCTTTACATCAACAGCCCGGGCGGCTCTATTACAGCCGGTATGGCGATCTATGATACC

ATGCAGTTTATTAAGCCGAAGGTATCTACAATTTGTATCGGTATGGCTGCGTCAATGGGCGCGTTCCTGCTTGCAGCCGG

CGAAAAAGGCAAACGCTATGCGCTTCCAAACAGTGAAGTCATGATTCACCAGCCACTTGGCGGTGCGCAAGGTCAAGCGA

CAGAAATTGAAATTGCTGCGAAACGCATTCTCTTGCTTCGTGACAAATTAAACAAAGTCCTAGCTGAACGTACTGGCCAG

CCGCTTGAAGTGATCGAACGTGACACAGACCGTGATAACTTCAAGTCTGCTGAAGAAGCGCTTGAATACGGCCTGATTGA

CAAAATTTTGACTCACACAGAAGACAAAAAGTAA

Domains

Predicted by InterproScan.

Clp protease (CLP_protease)

(13-192)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A199WEF2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Bacillus subtilis subsp. subtilis str. 168	100	100	1
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	68.617	95.431	0.655
clpP	Streptococcus thermophilus LMG 18311	58.163	99.492	0.579
clpP	Streptococcus thermophilus LMD-9	58.163	99.492	0.579
clpP	Streptococcus pneumoniae D39	57.812	97.462	0.563
clpP	Streptococcus pneumoniae Rx1	57.812	97.462	0.563
clpP	Streptococcus pneumoniae R6	57.812	97.462	0.563
clpP	Streptococcus pneumoniae TIGR4	57.812	97.462	0.563
clpP	Lactococcus lactis subsp. cremoris KW2	57.895	96.447	0.558
clpP	Streptococcus pyogenes JRS4	56.122	99.492	0.558
clpP	Streptococcus pyogenes MGAS315	56.122	99.492	0.558
clpP	Streptococcus mutans UA159	54.822	100	0.548
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	55.789	96.447	0.538

Detailed information NTG0713108