Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | NN994_RS01495 | Genome accession | NZ_CP101646 |
| Coordinates | 267414..267623 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain UCCSt95 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 262414..272623
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NN994_RS01465 (NN994_01465) | - | 262852..263361 (+) | 510 | WP_064355639.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| NN994_RS01470 (NN994_01470) | - | 263673..264230 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| NN994_RS01475 (NN994_01475) | - | 264233..264883 (+) | 651 | WP_011226853.1 | phosphatase PAP2 family protein | - |
| NN994_RS01480 (NN994_01480) | comR | 265078..265977 (+) | 900 | WP_064355637.1 | helix-turn-helix domain-containing protein | Regulator |
| NN994_RS01485 (NN994_01485) | - | 266215..266796 (+) | 582 | Protein_237 | cysteine peptidase family C39 domain-containing protein | - |
| NN994_RS01490 (NN994_01490) | comA | 266781..267071 (+) | 291 | WP_194238295.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| NN994_RS01495 (NN994_01495) | comA | 267414..267623 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| NN994_RS01500 (NN994_01500) | - | 267678..268246 (+) | 569 | Protein_240 | ATP-binding cassette domain-containing protein | - |
| NN994_RS01505 (NN994_01505) | - | 268354..268671 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| NN994_RS01510 (NN994_01510) | - | 268634..268918 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| NN994_RS01515 (NN994_01515) | - | 269158..270054 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| NN994_RS01520 (NN994_01520) | - | 270459..270974 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| NN994_RS01525 (NN994_01525) | - | 270999..271301 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| NN994_RS01530 (NN994_01530) | - | 271313..271624 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=711199 NN994_RS01495 WP_002946147.1 267414..267623(+) (comA) [Streptococcus thermophilus strain UCCSt95]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=711199 NN994_RS01495 WP_002946147.1 267414..267623(+) (comA) [Streptococcus thermophilus strain UCCSt95]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |