Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NLA26_RS14545 | Genome accession | NZ_CP101123 |
| Coordinates | 2906305..2906775 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus strain MN8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2869394..2911936 | 2906305..2906775 | within | 0 |
Gene organization within MGE regions
Location: 2869394..2911936
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NLA26_RS14275 | groES | 2869394..2869678 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| NLA26_RS14280 | groL | 2869754..2871370 (+) | 1617 | WP_000240651.1 | chaperonin GroEL | - |
| NLA26_RS14285 | - | 2871439..2872611 (-) | 1173 | WP_000179345.1 | tyrosine-type recombinase/integrase | - |
| NLA26_RS14290 | - | 2872625..2873299 (-) | 675 | WP_000620857.1 | helix-turn-helix transcriptional regulator | - |
| NLA26_RS14295 | - | 2873472..2873690 (+) | 219 | WP_000153640.1 | helix-turn-helix domain-containing protein | - |
| NLA26_RS14300 | - | 2873695..2874012 (+) | 318 | WP_000481967.1 | helix-turn-helix domain-containing protein | - |
| NLA26_RS14305 | - | 2874009..2874164 (+) | 156 | WP_000708433.1 | hypothetical protein | - |
| NLA26_RS14310 | - | 2874149..2874352 (+) | 204 | WP_001231378.1 | hypothetical protein | - |
| NLA26_RS14315 | - | 2874354..2874737 (+) | 384 | WP_000403839.1 | hypothetical protein | - |
| NLA26_RS14320 | - | 2874738..2875055 (+) | 318 | WP_001103930.1 | type II toxin-antitoxin system toxin TscT | - |
| NLA26_RS14325 | - | 2875119..2875988 (+) | 870 | WP_001002716.1 | primase alpha helix C-terminal domain-containing protein | - |
| NLA26_RS14330 | - | 2876002..2877711 (+) | 1710 | WP_000447451.1 | DUF927 domain-containing protein | - |
| NLA26_RS14335 | - | 2877787..2878167 (+) | 381 | WP_000356937.1 | hypothetical protein | - |
| NLA26_RS14340 | - | 2878164..2878805 (+) | 642 | WP_001019766.1 | hypothetical protein | - |
| NLA26_RS14345 | - | 2879341..2879682 (+) | 342 | WP_001190608.1 | hypothetical protein | - |
| NLA26_RS14350 | - | 2879694..2880272 (+) | 579 | WP_000846285.1 | hypothetical protein | - |
| NLA26_RS14355 | - | 2880290..2880508 (+) | 219 | WP_000448775.1 | capsid morphogenesis B protein | - |
| NLA26_RS14360 | - | 2880559..2881086 (+) | 528 | WP_000771368.1 | spore coat protein | - |
| NLA26_RS14365 | - | 2881089..2881430 (+) | 342 | WP_000358778.1 | hypothetical protein | - |
| NLA26_RS14370 | - | 2881427..2881996 (+) | 570 | WP_001293073.1 | terminase small subunit | - |
| NLA26_RS14375 | tst | 2882151..2882855 (-) | 705 | WP_001035597.1 | toxic shock syndrome toxin TSST-1 | - |
| NLA26_RS14380 | - | 2883274..2883501 (+) | 228 | WP_000812237.1 | hypothetical protein | - |
| NLA26_RS14385 | - | 2883975..2884250 (+) | 276 | Protein_2796 | hypothetical protein | - |
| NLA26_RS14390 | - | 2884356..2885291 (-) | 936 | WP_001239269.1 | TDT family transporter | - |
| NLA26_RS14395 | - | 2886410..2886589 (+) | 180 | WP_000201397.1 | hypothetical protein | - |
| NLA26_RS14400 | - | 2886586..2886882 (+) | 297 | WP_001573769.1 | hypothetical protein | - |
| NLA26_RS14405 | - | 2886872..2887213 (+) | 342 | WP_001573771.1 | hypothetical protein | - |
| NLA26_RS14410 | - | 2887791..2889098 (-) | 1308 | WP_001045087.1 | TrkH family potassium uptake protein | - |
| NLA26_RS14415 | - | 2889537..2890760 (-) | 1224 | WP_000206618.1 | ArgE/DapE family deacylase | - |
| NLA26_RS14420 | - | 2891192..2892247 (+) | 1056 | WP_000791402.1 | leukocidin family pore-forming toxin | - |
| NLA26_RS14425 | - | 2892269..2893288 (+) | 1020 | WP_000595617.1 | leukocidin/hemolysin toxin family protein | - |
| NLA26_RS14430 | sph | 2893545..2894377 (-) | 833 | Protein_2805 | sphingomyelin phosphodiesterase | - |
| NLA26_RS14435 | - | 2894428..2895465 (-) | 1038 | WP_000857191.1 | site-specific integrase | - |
| NLA26_RS14440 | - | 2895524..2895988 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| NLA26_RS14445 | - | 2896088..2896270 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| NLA26_RS14450 | - | 2896474..2896815 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| NLA26_RS14455 | - | 2896821..2897753 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| NLA26_RS14460 | - | 2897769..2898482 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| NLA26_RS14465 | - | 2898445..2898618 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| NLA26_RS14470 | - | 2898615..2898878 (+) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| NLA26_RS14475 | - | 2898894..2899109 (+) | 216 | WP_001025874.1 | MW1434 family type I TA system toxin | - |
| NLA26_RS14480 | - | 2899098..2899427 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| NLA26_RS14485 | - | 2899478..2900230 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| NLA26_RS14490 | - | 2900246..2900443 (+) | 198 | WP_001148855.1 | hypothetical protein | - |
| NLA26_RS14495 | - | 2900474..2900614 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| NLA26_RS14500 | - | 2900629..2901261 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| NLA26_RS14505 | - | 2901320..2901640 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| NLA26_RS14510 | - | 2901637..2901798 (+) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| NLA26_RS14515 | - | 2901893..2902219 (+) | 327 | WP_000165375.1 | DUF2482 family protein | - |
| NLA26_RS14520 | - | 2902200..2902460 (+) | 261 | WP_000291503.1 | DUF1108 family protein | - |
| NLA26_RS14525 | - | 2902469..2902732 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| NLA26_RS14530 | - | 2902741..2904684 (+) | 1944 | WP_000700577.1 | AAA family ATPase | - |
| NLA26_RS14535 | - | 2904686..2905606 (+) | 921 | WP_000138472.1 | recombinase RecT | - |
| NLA26_RS14540 | - | 2905687..2906304 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| NLA26_RS14545 | ssbA | 2906305..2906775 (+) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| NLA26_RS14550 | - | 2906805..2907689 (+) | 885 | WP_000148316.1 | DnaD domain protein | - |
| NLA26_RS14555 | - | 2907696..2907914 (+) | 219 | WP_000338531.1 | hypothetical protein | - |
| NLA26_RS14560 | - | 2907923..2908232 (+) | 310 | Protein_2831 | RusA family crossover junction endodeoxyribonuclease | - |
| NLA26_RS14565 | - | 2908245..2908613 (+) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| NLA26_RS14570 | - | 2908617..2908859 (+) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| NLA26_RS14575 | - | 2908871..2909038 (+) | 168 | WP_001624242.1 | hypothetical protein | - |
| NLA26_RS14580 | - | 2909031..2909282 (+) | 252 | WP_001065091.1 | DUF1024 family protein | - |
| NLA26_RS14585 | - | 2909272..2909454 (+) | 183 | WP_000028422.1 | hypothetical protein | - |
| NLA26_RS14590 | - | 2909447..2909989 (+) | 543 | WP_000185659.1 | dUTP diphosphatase | - |
| NLA26_RS14595 | - | 2910026..2910232 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| NLA26_RS14600 | - | 2910229..2910615 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| NLA26_RS14605 | - | 2910612..2910761 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| NLA26_RS14610 | - | 2910761..2910961 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| NLA26_RS14615 | - | 2910989..2911405 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| NLA26_RS14620 | - | 2911637..2911936 (+) | 300 | WP_000988330.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=708852 NLA26_RS14545 WP_000934764.1 2906305..2906775(+) (ssbA) [Staphylococcus aureus strain MN8]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=708852 NLA26_RS14545 WP_000934764.1 2906305..2906775(+) (ssbA) [Staphylococcus aureus strain MN8]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |