Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | M5C72_RS02610 | Genome accession | NZ_CP099481 |
| Coordinates | 535462..535929 (+) | Length | 155 a.a. |
| NCBI ID | WP_076614558.1 | Uniprot ID | A0A1P8Q2J2 |
| Organism | Companilactobacillus allii strain WiKim39 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 525687..569833 | 535462..535929 | within | 0 |
Gene organization within MGE regions
Location: 525687..569833
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5C72_RS02535 (M5C72_02535) | - | 525687..526802 (-) | 1116 | WP_076614542.1 | site-specific integrase | - |
| M5C72_RS02540 (M5C72_02540) | - | 526964..527671 (-) | 708 | WP_076614543.1 | hypothetical protein | - |
| M5C72_RS02545 (M5C72_02545) | - | 527733..528434 (-) | 702 | WP_076614544.1 | S24 family peptidase | - |
| M5C72_RS12940 | - | 528576..528809 (+) | 234 | WP_076614545.1 | helix-turn-helix transcriptional regulator | - |
| M5C72_RS02550 (M5C72_02550) | - | 528989..529387 (+) | 399 | WP_125673057.1 | hypothetical protein | - |
| M5C72_RS02555 (M5C72_02555) | - | 529374..529709 (+) | 336 | WP_076614547.1 | DUF771 domain-containing protein | - |
| M5C72_RS02560 (M5C72_02560) | - | 529711..529989 (+) | 279 | WP_076614548.1 | hypothetical protein | - |
| M5C72_RS02565 (M5C72_02565) | - | 530388..530930 (+) | 543 | WP_076614549.1 | host-nuclease inhibitor Gam family protein | - |
| M5C72_RS02570 (M5C72_02570) | - | 530933..531682 (+) | 750 | WP_076614550.1 | ERF family protein | - |
| M5C72_RS02575 (M5C72_02575) | - | 531712..532506 (+) | 795 | WP_076614551.1 | DnaD domain protein | - |
| M5C72_RS02580 (M5C72_02580) | - | 532528..533286 (+) | 759 | WP_225972245.1 | AAA family ATPase | - |
| M5C72_RS02585 (M5C72_02585) | - | 533289..533576 (+) | 288 | WP_076614553.1 | hypothetical protein | - |
| M5C72_RS02590 (M5C72_02590) | - | 533591..533872 (+) | 282 | WP_076614554.1 | hypothetical protein | - |
| M5C72_RS02595 (M5C72_02595) | - | 533873..534316 (+) | 444 | WP_076614555.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M5C72_RS02600 (M5C72_02600) | - | 534330..534524 (+) | 195 | WP_257787700.1 | helix-turn-helix transcriptional regulator | - |
| M5C72_RS02605 (M5C72_02605) | - | 534701..535465 (+) | 765 | WP_076614557.1 | phage antirepressor | - |
| M5C72_RS02610 (M5C72_02610) | ssb | 535462..535929 (+) | 468 | WP_076614558.1 | single-stranded DNA-binding protein | Machinery gene |
| M5C72_RS02615 (M5C72_02615) | - | 535943..536695 (+) | 753 | WP_076614559.1 | site-specific DNA-methyltransferase | - |
| M5C72_RS02620 (M5C72_02620) | - | 536710..536919 (+) | 210 | WP_076614560.1 | hypothetical protein | - |
| M5C72_RS02625 (M5C72_02625) | - | 536935..537153 (+) | 219 | WP_076614561.1 | hypothetical protein | - |
| M5C72_RS02630 (M5C72_02630) | - | 537150..538277 (+) | 1128 | WP_076614562.1 | DNA cytosine methyltransferase | - |
| M5C72_RS02635 (M5C72_02635) | - | 538291..538713 (+) | 423 | WP_076614563.1 | hypothetical protein | - |
| M5C72_RS02640 (M5C72_02640) | - | 538703..538864 (+) | 162 | WP_157886442.1 | hypothetical protein | - |
| M5C72_RS02645 (M5C72_02645) | - | 538949..539356 (+) | 408 | WP_076614564.1 | hypothetical protein | - |
| M5C72_RS02650 (M5C72_02650) | - | 539480..539905 (+) | 426 | WP_076614565.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M5C72_RS02655 (M5C72_02655) | - | 540410..540670 (+) | 261 | WP_076614566.1 | Gp49 family protein | - |
| M5C72_RS02660 (M5C72_02660) | - | 540670..540873 (+) | 204 | WP_076614567.1 | hypothetical protein | - |
| M5C72_RS02665 (M5C72_02665) | - | 540913..541143 (+) | 231 | WP_076614568.1 | hypothetical protein | - |
| M5C72_RS02670 (M5C72_02670) | - | 541146..541328 (+) | 183 | WP_125673045.1 | hypothetical protein | - |
| M5C72_RS02675 (M5C72_02675) | - | 541288..541602 (+) | 315 | WP_125673046.1 | hypothetical protein | - |
| M5C72_RS02680 (M5C72_02680) | - | 541602..542177 (+) | 576 | WP_076614570.1 | ParB N-terminal domain-containing protein | - |
| M5C72_RS02685 (M5C72_02685) | - | 542174..542941 (+) | 768 | WP_076614571.1 | hypothetical protein | - |
| M5C72_RS02690 (M5C72_02690) | - | 542953..543669 (+) | 717 | WP_076614572.1 | queuosine precursor transporter | - |
| M5C72_RS02695 (M5C72_02695) | queC | 543682..544383 (+) | 702 | WP_076614573.1 | 7-cyano-7-deazaguanine synthase QueC | - |
| M5C72_RS02700 (M5C72_02700) | - | 544423..545076 (+) | 654 | WP_076614574.1 | helix-turn-helix domain-containing protein | - |
| M5C72_RS02705 (M5C72_02705) | - | 545060..546379 (+) | 1320 | WP_076614575.1 | PBSX family phage terminase large subunit | - |
| M5C72_RS02710 (M5C72_02710) | - | 546398..548008 (+) | 1611 | WP_076614576.1 | phage portal protein | - |
| M5C72_RS02715 (M5C72_02715) | - | 547989..548348 (+) | 360 | WP_076614577.1 | hypothetical protein | - |
| M5C72_RS02720 (M5C72_02720) | - | 548335..549324 (+) | 990 | WP_076614578.1 | minor capsid protein | - |
| M5C72_RS02725 (M5C72_02725) | - | 549319..549816 (-) | 498 | WP_076614579.1 | hypothetical protein | - |
| M5C72_RS02730 (M5C72_02730) | - | 549979..550638 (+) | 660 | WP_076614580.1 | DUF4355 domain-containing protein | - |
| M5C72_RS02735 (M5C72_02735) | - | 550651..550977 (+) | 327 | WP_076614581.1 | hypothetical protein | - |
| M5C72_RS02740 (M5C72_02740) | - | 550981..551994 (+) | 1014 | WP_076614582.1 | major capsid protein | - |
| M5C72_RS02745 (M5C72_02745) | - | 552101..552451 (+) | 351 | WP_076614583.1 | phage head-tail connector protein | - |
| M5C72_RS02750 (M5C72_02750) | - | 552448..552771 (+) | 324 | WP_076614584.1 | hypothetical protein | - |
| M5C72_RS02755 (M5C72_02755) | - | 552768..553247 (+) | 480 | WP_076614585.1 | hypothetical protein | - |
| M5C72_RS02760 (M5C72_02760) | - | 553278..553652 (+) | 375 | WP_076614586.1 | DUF6838 family protein | - |
| M5C72_RS02765 (M5C72_02765) | - | 553705..554490 (+) | 786 | WP_076614587.1 | hypothetical protein | - |
| M5C72_RS02770 (M5C72_02770) | - | 554511..554789 (+) | 279 | WP_076614588.1 | hypothetical protein | - |
| M5C72_RS02775 (M5C72_02775) | - | 554858..555325 (+) | 468 | WP_076614589.1 | hypothetical protein | - |
| M5C72_RS02780 (M5C72_02780) | - | 555349..555663 (+) | 315 | WP_076614590.1 | hypothetical protein | - |
| M5C72_RS02785 (M5C72_02785) | - | 555664..560163 (+) | 4500 | WP_076614591.1 | tape measure protein | - |
| M5C72_RS02790 (M5C72_02790) | - | 560165..561091 (+) | 927 | WP_076614592.1 | phage tail domain-containing protein | - |
| M5C72_RS02795 (M5C72_02795) | - | 561091..563325 (+) | 2235 | WP_125673047.1 | phage tail protein | - |
| M5C72_RS02800 (M5C72_02800) | - | 563328..564041 (+) | 714 | WP_076614595.1 | hypothetical protein | - |
| M5C72_RS02805 (M5C72_02805) | - | 564045..565073 (+) | 1029 | WP_076614596.1 | BppU family phage baseplate upper protein | - |
| M5C72_RS02810 (M5C72_02810) | - | 565073..565348 (+) | 276 | WP_076614597.1 | hypothetical protein | - |
| M5C72_RS02815 (M5C72_02815) | - | 565351..567240 (+) | 1890 | WP_076614598.1 | hypothetical protein | - |
| M5C72_RS02820 (M5C72_02820) | - | 567240..567680 (+) | 441 | WP_076614599.1 | hypothetical protein | - |
| M5C72_RS02825 (M5C72_02825) | - | 567693..567824 (+) | 132 | WP_083685936.1 | XkdX family protein | - |
| M5C72_RS02830 (M5C72_02830) | - | 568242..568556 (+) | 315 | WP_076614601.1 | hypothetical protein | - |
| M5C72_RS02835 (M5C72_02835) | - | 568556..568846 (+) | 291 | WP_076614602.1 | hypothetical protein | - |
| M5C72_RS02840 (M5C72_02840) | - | 568847..569833 (+) | 987 | WP_076614603.1 | SLAP domain-containing protein | - |
Sequence
Protein
Download Length: 155 a.a. Molecular weight: 17204.99 Da Isoelectric Point: 6.3802
>NTDB_id=699931 M5C72_RS02610 WP_076614558.1 535462..535929(+) (ssb) [Companilactobacillus allii strain WiKim39]
MINTVALTGRLTRDPELRYTSSNKPVASFKLAVNRQYTNSNGEREADFIDCVIWRGAEALVNNTSKGSLIGVEGRLQTRS
YENQQGSRVFVTEVVCSSFSFLESKSEKQQKNNTDTNGYSNKLAEKTNKPAANKNADPFADNSKPIDISDDDLPF
MINTVALTGRLTRDPELRYTSSNKPVASFKLAVNRQYTNSNGEREADFIDCVIWRGAEALVNNTSKGSLIGVEGRLQTRS
YENQQGSRVFVTEVVCSSFSFLESKSEKQQKNNTDTNGYSNKLAEKTNKPAANKNADPFADNSKPIDISDDDLPF
Nucleotide
Download Length: 468 bp
>NTDB_id=699931 M5C72_RS02610 WP_076614558.1 535462..535929(+) (ssb) [Companilactobacillus allii strain WiKim39]
ATGATTAACACCGTAGCGTTAACAGGACGCCTGACACGTGATCCAGAACTTAGATACACGTCAAGCAATAAACCGGTAGC
AAGCTTCAAGCTGGCAGTTAACAGGCAATACACCAACTCAAATGGTGAACGAGAAGCAGACTTTATTGATTGTGTTATCT
GGCGTGGCGCTGAGGCATTAGTCAACAACACGAGTAAAGGTTCACTTATTGGTGTTGAGGGACGTTTACAAACACGTTCT
TATGAGAATCAGCAAGGCTCACGTGTATTTGTGACTGAGGTTGTATGCAGCAGTTTCTCATTTTTGGAGTCTAAGTCAGA
GAAACAGCAGAAAAATAATACTGATACCAATGGTTACAGCAATAAACTAGCAGAAAAGACAAATAAACCTGCAGCAAATA
AGAATGCCGATCCATTTGCAGATAACAGCAAACCGATAGATATATCGGATGACGATTTGCCATTCTAA
ATGATTAACACCGTAGCGTTAACAGGACGCCTGACACGTGATCCAGAACTTAGATACACGTCAAGCAATAAACCGGTAGC
AAGCTTCAAGCTGGCAGTTAACAGGCAATACACCAACTCAAATGGTGAACGAGAAGCAGACTTTATTGATTGTGTTATCT
GGCGTGGCGCTGAGGCATTAGTCAACAACACGAGTAAAGGTTCACTTATTGGTGTTGAGGGACGTTTACAAACACGTTCT
TATGAGAATCAGCAAGGCTCACGTGTATTTGTGACTGAGGTTGTATGCAGCAGTTTCTCATTTTTGGAGTCTAAGTCAGA
GAAACAGCAGAAAAATAATACTGATACCAATGGTTACAGCAATAAACTAGCAGAAAAGACAAATAAACCTGCAGCAAATA
AGAATGCCGATCCATTTGCAGATAACAGCAAACCGATAGATATATCGGATGACGATTTGCCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.725 |
100 |
0.626 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
53.488 |
100 |
0.594 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.511 |
84.516 |
0.368 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
50.909 |
70.968 |
0.361 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.748 |
84.516 |
0.361 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.748 |
84.516 |
0.361 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.748 |
84.516 |
0.361 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.748 |
84.516 |
0.361 |