Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYKS030_RS06035 | Genome accession | NZ_AP018337 |
| Coordinates | 1113691..1113879 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain KS030 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1103763..1153267 | 1113691..1113879 | within | 0 |
Gene organization within MGE regions
Location: 1103763..1153267
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYKS030_RS05990 (SPYKS030_11220) | lepB | 1103763..1104320 (-) | 558 | WP_002984449.1 | signal peptidase I | - |
| SPYKS030_RS05995 (SPYKS030_11230) | pyk | 1104538..1106040 (-) | 1503 | WP_011054543.1 | pyruvate kinase | - |
| SPYKS030_RS06000 (SPYKS030_11240) | pfkA | 1106103..1107116 (-) | 1014 | WP_011054544.1 | 6-phosphofructokinase | - |
| SPYKS030_RS06005 (SPYKS030_11250) | - | 1107196..1110306 (-) | 3111 | WP_011054545.1 | DNA polymerase III subunit alpha | - |
| SPYKS030_RS06010 (SPYKS030_11260) | - | 1110491..1110862 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| SPYKS030_RS06015 (SPYKS030_11270) | - | 1110862..1111560 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| SPYKS030_RS06020 (SPYKS030_11280) | - | 1111570..1112355 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| SPYKS030_RS06025 (SPYKS030_11290) | - | 1112486..1113100 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| SPYKS030_RS06035 (SPYKS030_11300) | prx | 1113691..1113879 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| SPYKS030_RS06040 (SPYKS030_11310) | entC3 | 1113992..1114774 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| SPYKS030_RS06045 (SPYKS030_11320) | - | 1114987..1116111 (-) | 1125 | WP_011054547.1 | Fic family protein | - |
| SPYKS030_RS06050 (SPYKS030_11330) | - | 1116249..1117457 (-) | 1209 | WP_011054548.1 | glucosaminidase domain-containing protein | - |
| SPYKS030_RS06055 (SPYKS030_11340) | - | 1117573..1117800 (-) | 228 | WP_011054444.1 | phage holin | - |
| SPYKS030_RS06060 (SPYKS030_11350) | - | 1117797..1118069 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| SPYKS030_RS06065 (SPYKS030_11360) | - | 1118081..1118713 (-) | 633 | WP_011054443.1 | hypothetical protein | - |
| SPYKS030_RS06070 (SPYKS030_11370) | - | 1118716..1119144 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| SPYKS030_RS06075 (SPYKS030_11380) | - | 1119156..1121060 (-) | 1905 | WP_011054442.1 | gp58-like family protein | - |
| SPYKS030_RS06080 (SPYKS030_11390) | - | 1121070..1122076 (-) | 1007 | Protein_1131 | hyaluronoglucosaminidase | - |
| SPYKS030_RS06085 (SPYKS030_11400) | - | 1122073..1124124 (-) | 2052 | WP_011054440.1 | phage tail spike protein | - |
| SPYKS030_RS06090 (SPYKS030_11410) | - | 1124121..1124891 (-) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| SPYKS030_RS06095 (SPYKS030_11420) | - | 1124904..1129004 (-) | 4101 | WP_011054439.1 | phage tail tape measure protein | - |
| SPYKS030_RS06105 (SPYKS030_11440) | gpG | 1129230..1129532 (-) | 303 | WP_011017390.1 | phage tail assembly chaperone G | - |
| SPYKS030_RS06110 (SPYKS030_11450) | - | 1129625..1130209 (-) | 585 | WP_011017389.1 | major tail protein | - |
| SPYKS030_RS06115 (SPYKS030_11460) | - | 1130221..1130601 (-) | 381 | WP_011017388.1 | hypothetical protein | - |
| SPYKS030_RS06120 (SPYKS030_11470) | - | 1130594..1130992 (-) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| SPYKS030_RS06125 (SPYKS030_11480) | - | 1130994..1131356 (-) | 363 | WP_011017386.1 | hypothetical protein | - |
| SPYKS030_RS06130 (SPYKS030_11490) | - | 1131349..1131657 (-) | 309 | WP_011054437.1 | hypothetical protein | - |
| SPYKS030_RS10075 | - | 1131657..1131830 (-) | 174 | WP_011017384.1 | hypothetical protein | - |
| SPYKS030_RS06135 (SPYKS030_11500) | - | 1131844..1132977 (-) | 1134 | WP_011017383.1 | phage major capsid protein | - |
| SPYKS030_RS06140 (SPYKS030_11510) | - | 1132994..1133800 (-) | 807 | WP_011017382.1 | head maturation protease, ClpP-related | - |
| SPYKS030_RS06145 (SPYKS030_11520) | - | 1133781..1134968 (-) | 1188 | WP_011017381.1 | phage portal protein | - |
| SPYKS030_RS06150 (SPYKS030_11530) | - | 1135111..1135323 (-) | 213 | WP_136260634.1 | hypothetical protein | - |
| SPYKS030_RS06155 (SPYKS030_11540) | - | 1135326..1137056 (-) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| SPYKS030_RS06160 (SPYKS030_11550) | - | 1137069..1137386 (-) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| SPYKS030_RS06165 (SPYKS030_11560) | - | 1137527..1137832 (-) | 306 | WP_011017378.1 | HNH endonuclease | - |
| SPYKS030_RS06170 (SPYKS030_11570) | - | 1137825..1138211 (-) | 387 | WP_011017377.1 | hypothetical protein | - |
| SPYKS030_RS06175 (SPYKS030_11580) | - | 1138237..1138440 (-) | 204 | WP_011017376.1 | hypothetical protein | - |
| SPYKS030_RS06180 (SPYKS030_11590) | - | 1138498..1138791 (-) | 294 | WP_011017375.1 | hypothetical protein | - |
| SPYKS030_RS06185 (SPYKS030_11600) | - | 1138945..1139520 (-) | 576 | WP_011054435.1 | site-specific integrase | - |
| SPYKS030_RS06190 (SPYKS030_11610) | - | 1139680..1140081 (-) | 402 | WP_011017373.1 | hypothetical protein | - |
| SPYKS030_RS06195 (SPYKS030_11620) | - | 1140096..1140923 (-) | 828 | WP_011054433.1 | prohibitin family protein | - |
| SPYKS030_RS06200 (SPYKS030_11630) | - | 1140925..1141263 (-) | 339 | WP_011054432.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS06205 (SPYKS030_11640) | - | 1141260..1141541 (-) | 282 | WP_011054431.1 | hypothetical protein | - |
| SPYKS030_RS06210 (SPYKS030_11650) | - | 1141556..1141747 (-) | 192 | Protein_1157 | single-stranded DNA-binding protein | - |
| SPYKS030_RS06215 (SPYKS030_11660) | - | 1141707..1142219 (-) | 513 | WP_011054429.1 | DUF1642 domain-containing protein | - |
| SPYKS030_RS06220 (SPYKS030_11670) | - | 1142224..1142856 (-) | 633 | WP_011054428.1 | N-6 DNA methylase | - |
| SPYKS030_RS06225 (SPYKS030_11680) | - | 1142858..1143142 (-) | 285 | WP_011054427.1 | hypothetical protein | - |
| SPYKS030_RS06230 (SPYKS030_11690) | - | 1143139..1143573 (-) | 435 | WP_011054426.1 | YopX family protein | - |
| SPYKS030_RS06235 (SPYKS030_11700) | - | 1143590..1143796 (-) | 207 | WP_011054425.1 | hypothetical protein | - |
| SPYKS030_RS06240 (SPYKS030_11710) | - | 1143810..1144037 (-) | 228 | WP_011054424.1 | hypothetical protein | - |
| SPYKS030_RS10215 (SPYKS030_11720) | - | 1144037..1144849 (-) | 813 | Protein_1164 | ATP-binding protein | - |
| SPYKS030_RS06250 (SPYKS030_11730) | - | 1144849..1145610 (-) | 762 | WP_011054422.1 | conserved phage C-terminal domain-containing protein | - |
| SPYKS030_RS06255 (SPYKS030_11740) | dnaB | 1145603..1146943 (-) | 1341 | WP_011017360.1 | replicative DNA helicase | - |
| SPYKS030_RS06260 (SPYKS030_11750) | - | 1146930..1147118 (-) | 189 | WP_032461348.1 | hypothetical protein | - |
| SPYKS030_RS06265 (SPYKS030_11760) | - | 1147239..1147430 (-) | 192 | WP_011017359.1 | hypothetical protein | - |
| SPYKS030_RS06270 (SPYKS030_11770) | - | 1147523..1147780 (-) | 258 | WP_011054421.1 | hypothetical protein | - |
| SPYKS030_RS06275 (SPYKS030_11780) | - | 1147854..1148573 (-) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| SPYKS030_RS06280 (SPYKS030_11790) | - | 1148615..1149124 (+) | 510 | WP_011106801.1 | hypothetical protein | - |
| SPYKS030_RS10340 | - | 1149244..1149378 (-) | 135 | WP_011017356.1 | hypothetical protein | - |
| SPYKS030_RS06285 (SPYKS030_11800) | - | 1149452..1149664 (-) | 213 | WP_011054420.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS06290 (SPYKS030_11810) | - | 1149699..1149974 (-) | 276 | WP_011017354.1 | hypothetical protein | - |
| SPYKS030_RS06295 (SPYKS030_11820) | - | 1150263..1150613 (+) | 351 | WP_011017353.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS06300 (SPYKS030_11830) | - | 1150617..1151009 (+) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYKS030_RS06305 (SPYKS030_11840) | - | 1151020..1151760 (+) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| SPYKS030_RS06310 (SPYKS030_11850) | - | 1152071..1153267 (+) | 1197 | WP_011017350.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=69001 SPYKS030_RS06035 WP_011054546.1 1113691..1113879(-) (prx) [Streptococcus pyogenes strain KS030]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=69001 SPYKS030_RS06035 WP_011054546.1 1113691..1113879(-) (prx) [Streptococcus pyogenes strain KS030]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |