Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   SPYKS030_RS06035 Genome accession   NZ_AP018337
Coordinates   1113691..1113879 (-) Length   62 a.a.
NCBI ID   WP_011054546.1    Uniprot ID   A0A5S4TJS4
Organism   Streptococcus pyogenes strain KS030     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1103763..1153267 1113691..1113879 within 0


Gene organization within MGE regions


Location: 1103763..1153267
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPYKS030_RS05990 (SPYKS030_11220) lepB 1103763..1104320 (-) 558 WP_002984449.1 signal peptidase I -
  SPYKS030_RS05995 (SPYKS030_11230) pyk 1104538..1106040 (-) 1503 WP_011054543.1 pyruvate kinase -
  SPYKS030_RS06000 (SPYKS030_11240) pfkA 1106103..1107116 (-) 1014 WP_011054544.1 6-phosphofructokinase -
  SPYKS030_RS06005 (SPYKS030_11250) - 1107196..1110306 (-) 3111 WP_011054545.1 DNA polymerase III subunit alpha -
  SPYKS030_RS06010 (SPYKS030_11260) - 1110491..1110862 (+) 372 WP_002989617.1 GntR family transcriptional regulator -
  SPYKS030_RS06015 (SPYKS030_11270) - 1110862..1111560 (+) 699 WP_002984437.1 ABC transporter ATP-binding protein -
  SPYKS030_RS06020 (SPYKS030_11280) - 1111570..1112355 (+) 786 WP_002984433.1 hypothetical protein -
  SPYKS030_RS06025 (SPYKS030_11290) - 1112486..1113100 (-) 615 WP_002989607.1 TVP38/TMEM64 family protein -
  SPYKS030_RS06035 (SPYKS030_11300) prx 1113691..1113879 (-) 189 WP_011054546.1 hypothetical protein Regulator
  SPYKS030_RS06040 (SPYKS030_11310) entC3 1113992..1114774 (-) 783 WP_002988472.1 enterotoxin type C3 EntC3 -
  SPYKS030_RS06045 (SPYKS030_11320) - 1114987..1116111 (-) 1125 WP_011054547.1 Fic family protein -
  SPYKS030_RS06050 (SPYKS030_11330) - 1116249..1117457 (-) 1209 WP_011054548.1 glucosaminidase domain-containing protein -
  SPYKS030_RS06055 (SPYKS030_11340) - 1117573..1117800 (-) 228 WP_011054444.1 phage holin -
  SPYKS030_RS06060 (SPYKS030_11350) - 1117797..1118069 (-) 273 WP_011017397.1 hypothetical protein -
  SPYKS030_RS06065 (SPYKS030_11360) - 1118081..1118713 (-) 633 WP_011054443.1 hypothetical protein -
  SPYKS030_RS06070 (SPYKS030_11370) - 1118716..1119144 (-) 429 WP_002988448.1 DUF1617 family protein -
  SPYKS030_RS06075 (SPYKS030_11380) - 1119156..1121060 (-) 1905 WP_011054442.1 gp58-like family protein -
  SPYKS030_RS06080 (SPYKS030_11390) - 1121070..1122076 (-) 1007 Protein_1131 hyaluronoglucosaminidase -
  SPYKS030_RS06085 (SPYKS030_11400) - 1122073..1124124 (-) 2052 WP_011054440.1 phage tail spike protein -
  SPYKS030_RS06090 (SPYKS030_11410) - 1124121..1124891 (-) 771 WP_011017392.1 distal tail protein Dit -
  SPYKS030_RS06095 (SPYKS030_11420) - 1124904..1129004 (-) 4101 WP_011054439.1 phage tail tape measure protein -
  SPYKS030_RS06105 (SPYKS030_11440) gpG 1129230..1129532 (-) 303 WP_011017390.1 phage tail assembly chaperone G -
  SPYKS030_RS06110 (SPYKS030_11450) - 1129625..1130209 (-) 585 WP_011017389.1 major tail protein -
  SPYKS030_RS06115 (SPYKS030_11460) - 1130221..1130601 (-) 381 WP_011017388.1 hypothetical protein -
  SPYKS030_RS06120 (SPYKS030_11470) - 1130594..1130992 (-) 399 WP_011017387.1 HK97 gp10 family phage protein -
  SPYKS030_RS06125 (SPYKS030_11480) - 1130994..1131356 (-) 363 WP_011017386.1 hypothetical protein -
  SPYKS030_RS06130 (SPYKS030_11490) - 1131349..1131657 (-) 309 WP_011054437.1 hypothetical protein -
  SPYKS030_RS10075 - 1131657..1131830 (-) 174 WP_011017384.1 hypothetical protein -
  SPYKS030_RS06135 (SPYKS030_11500) - 1131844..1132977 (-) 1134 WP_011017383.1 phage major capsid protein -
  SPYKS030_RS06140 (SPYKS030_11510) - 1132994..1133800 (-) 807 WP_011017382.1 head maturation protease, ClpP-related -
  SPYKS030_RS06145 (SPYKS030_11520) - 1133781..1134968 (-) 1188 WP_011017381.1 phage portal protein -
  SPYKS030_RS06150 (SPYKS030_11530) - 1135111..1135323 (-) 213 WP_136260634.1 hypothetical protein -
  SPYKS030_RS06155 (SPYKS030_11540) - 1135326..1137056 (-) 1731 WP_011017380.1 terminase large subunit domain-containing protein -
  SPYKS030_RS06160 (SPYKS030_11550) - 1137069..1137386 (-) 318 WP_011017379.1 P27 family phage terminase small subunit -
  SPYKS030_RS06165 (SPYKS030_11560) - 1137527..1137832 (-) 306 WP_011017378.1 HNH endonuclease -
  SPYKS030_RS06170 (SPYKS030_11570) - 1137825..1138211 (-) 387 WP_011017377.1 hypothetical protein -
  SPYKS030_RS06175 (SPYKS030_11580) - 1138237..1138440 (-) 204 WP_011017376.1 hypothetical protein -
  SPYKS030_RS06180 (SPYKS030_11590) - 1138498..1138791 (-) 294 WP_011017375.1 hypothetical protein -
  SPYKS030_RS06185 (SPYKS030_11600) - 1138945..1139520 (-) 576 WP_011054435.1 site-specific integrase -
  SPYKS030_RS06190 (SPYKS030_11610) - 1139680..1140081 (-) 402 WP_011017373.1 hypothetical protein -
  SPYKS030_RS06195 (SPYKS030_11620) - 1140096..1140923 (-) 828 WP_011054433.1 prohibitin family protein -
  SPYKS030_RS06200 (SPYKS030_11630) - 1140925..1141263 (-) 339 WP_011054432.1 helix-turn-helix domain-containing protein -
  SPYKS030_RS06205 (SPYKS030_11640) - 1141260..1141541 (-) 282 WP_011054431.1 hypothetical protein -
  SPYKS030_RS06210 (SPYKS030_11650) - 1141556..1141747 (-) 192 Protein_1157 single-stranded DNA-binding protein -
  SPYKS030_RS06215 (SPYKS030_11660) - 1141707..1142219 (-) 513 WP_011054429.1 DUF1642 domain-containing protein -
  SPYKS030_RS06220 (SPYKS030_11670) - 1142224..1142856 (-) 633 WP_011054428.1 N-6 DNA methylase -
  SPYKS030_RS06225 (SPYKS030_11680) - 1142858..1143142 (-) 285 WP_011054427.1 hypothetical protein -
  SPYKS030_RS06230 (SPYKS030_11690) - 1143139..1143573 (-) 435 WP_011054426.1 YopX family protein -
  SPYKS030_RS06235 (SPYKS030_11700) - 1143590..1143796 (-) 207 WP_011054425.1 hypothetical protein -
  SPYKS030_RS06240 (SPYKS030_11710) - 1143810..1144037 (-) 228 WP_011054424.1 hypothetical protein -
  SPYKS030_RS10215 (SPYKS030_11720) - 1144037..1144849 (-) 813 Protein_1164 ATP-binding protein -
  SPYKS030_RS06250 (SPYKS030_11730) - 1144849..1145610 (-) 762 WP_011054422.1 conserved phage C-terminal domain-containing protein -
  SPYKS030_RS06255 (SPYKS030_11740) dnaB 1145603..1146943 (-) 1341 WP_011017360.1 replicative DNA helicase -
  SPYKS030_RS06260 (SPYKS030_11750) - 1146930..1147118 (-) 189 WP_032461348.1 hypothetical protein -
  SPYKS030_RS06265 (SPYKS030_11760) - 1147239..1147430 (-) 192 WP_011017359.1 hypothetical protein -
  SPYKS030_RS06270 (SPYKS030_11770) - 1147523..1147780 (-) 258 WP_011054421.1 hypothetical protein -
  SPYKS030_RS06275 (SPYKS030_11780) - 1147854..1148573 (-) 720 WP_011017357.1 ORF6C domain-containing protein -
  SPYKS030_RS06280 (SPYKS030_11790) - 1148615..1149124 (+) 510 WP_011106801.1 hypothetical protein -
  SPYKS030_RS10340 - 1149244..1149378 (-) 135 WP_011017356.1 hypothetical protein -
  SPYKS030_RS06285 (SPYKS030_11800) - 1149452..1149664 (-) 213 WP_011054420.1 helix-turn-helix domain-containing protein -
  SPYKS030_RS06290 (SPYKS030_11810) - 1149699..1149974 (-) 276 WP_011017354.1 hypothetical protein -
  SPYKS030_RS06295 (SPYKS030_11820) - 1150263..1150613 (+) 351 WP_011017353.1 helix-turn-helix domain-containing protein -
  SPYKS030_RS06300 (SPYKS030_11830) - 1150617..1151009 (+) 393 WP_011017352.1 ImmA/IrrE family metallo-endopeptidase -
  SPYKS030_RS06305 (SPYKS030_11840) - 1151020..1151760 (+) 741 WP_011017351.1 type II toxin-antitoxin system PemK/MazF family toxin -
  SPYKS030_RS06310 (SPYKS030_11850) - 1152071..1153267 (+) 1197 WP_011017350.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 62 a.a.        Molecular weight: 7226.17 Da        Isoelectric Point: 3.9947

>NTDB_id=69001 SPYKS030_RS06035 WP_011054546.1 1113691..1113879(-) (prx) [Streptococcus pyogenes strain KS030]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK

Nucleotide


Download         Length: 189 bp        

>NTDB_id=69001 SPYKS030_RS06035 WP_011054546.1 1113691..1113879(-) (prx) [Streptococcus pyogenes strain KS030]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5S4TJS4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

100

100

1

  prx Streptococcus pyogenes MGAS315

84.746

95.161

0.806

  prx Streptococcus pyogenes MGAS8232

84.483

93.548

0.79

  prx Streptococcus pyogenes MGAS315

82.759

93.548

0.774

  prx Streptococcus pyogenes MGAS315

77.966

95.161

0.742

  prx Streptococcus pyogenes MGAS315

87.805

66.129

0.581

  prx Streptococcus pyogenes MGAS315

76.19

67.742

0.516


Multiple sequence alignment