Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYKS030_RS05105 | Genome accession | NZ_AP018337 |
| Coordinates | 925346..925528 (+) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes strain KS030 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 884773..925147 | 925346..925528 | flank | 199 |
Gene organization within MGE regions
Location: 884773..925528
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYKS030_RS04820 (SPYKS030_08900) | - | 884773..885861 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| SPYKS030_RS04825 (SPYKS030_08910) | - | 885981..886286 (-) | 306 | WP_011106738.1 | membrane protein | - |
| SPYKS030_RS04830 (SPYKS030_08920) | - | 886296..887084 (-) | 789 | WP_021340822.1 | S24 family peptidase | - |
| SPYKS030_RS04835 (SPYKS030_08930) | - | 887457..887603 (+) | 147 | WP_011054593.1 | hypothetical protein | - |
| SPYKS030_RS04840 (SPYKS030_08940) | - | 887737..888516 (-) | 780 | WP_011054591.1 | hypothetical protein | - |
| SPYKS030_RS04845 (SPYKS030_08950) | - | 888573..888779 (+) | 207 | WP_011054590.1 | hypothetical protein | - |
| SPYKS030_RS04850 (SPYKS030_08960) | - | 888768..889154 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| SPYKS030_RS04855 (SPYKS030_08970) | - | 889228..889467 (+) | 240 | WP_011054588.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS04865 (SPYKS030_08990) | - | 889683..889892 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| SPYKS030_RS04870 (SPYKS030_09000) | - | 890043..890282 (-) | 240 | WP_011054586.1 | hypothetical protein | - |
| SPYKS030_RS04875 (SPYKS030_09010) | - | 890449..890634 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS04880 (SPYKS030_09020) | - | 890712..891008 (+) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| SPYKS030_RS10325 | - | 891005..891139 (+) | 135 | WP_002995985.1 | hypothetical protein | - |
| SPYKS030_RS04885 (SPYKS030_09030) | - | 891155..891469 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| SPYKS030_RS04890 (SPYKS030_09040) | - | 891698..892180 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| SPYKS030_RS04895 (SPYKS030_09050) | - | 892181..892861 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| SPYKS030_RS04900 (SPYKS030_09060) | - | 892963..894192 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| SPYKS030_RS04905 (SPYKS030_09070) | - | 894208..894666 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| SPYKS030_RS04910 (SPYKS030_09080) | - | 894669..895481 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| SPYKS030_RS10470 | - | 895471..896025 (+) | 555 | WP_011054578.1 | hypothetical protein | - |
| SPYKS030_RS04915 (SPYKS030_09090) | - | 895953..896945 (+) | 993 | WP_229309934.1 | phage/plasmid primase, P4 family | - |
| SPYKS030_RS04920 (SPYKS030_09100) | - | 897207..897620 (+) | 414 | WP_008087509.1 | hypothetical protein | - |
| SPYKS030_RS04925 (SPYKS030_09110) | - | 897617..897937 (+) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| SPYKS030_RS04930 (SPYKS030_09120) | - | 897921..898124 (+) | 204 | WP_011054575.1 | hypothetical protein | - |
| SPYKS030_RS04935 (SPYKS030_09130) | - | 898121..898405 (+) | 285 | WP_011106747.1 | hypothetical protein | - |
| SPYKS030_RS04940 (SPYKS030_09140) | - | 898430..898804 (+) | 375 | WP_011054574.1 | methyltransferase domain-containing protein | - |
| SPYKS030_RS04945 (SPYKS030_09150) | - | 898995..899396 (+) | 402 | WP_011054573.1 | hypothetical protein | - |
| SPYKS030_RS04950 (SPYKS030_09160) | - | 899396..900031 (+) | 636 | WP_011054572.1 | N-6 DNA methylase | - |
| SPYKS030_RS04960 (SPYKS030_09170) | - | 900304..900744 (+) | 441 | WP_011054571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPYKS030_RS04970 (SPYKS030_09190) | - | 901330..901668 (+) | 339 | WP_002985375.1 | HNH endonuclease | - |
| SPYKS030_RS04975 (SPYKS030_09200) | - | 901840..902307 (+) | 468 | WP_011054569.1 | phage terminase small subunit P27 family | - |
| SPYKS030_RS04980 (SPYKS030_09210) | - | 902322..904076 (+) | 1755 | WP_011054568.1 | terminase large subunit | - |
| SPYKS030_RS10055 | - | 904073..904243 (+) | 171 | WP_011054567.1 | hypothetical protein | - |
| SPYKS030_RS04985 (SPYKS030_09220) | - | 904236..904502 (+) | 267 | WP_011054566.1 | hypothetical protein | - |
| SPYKS030_RS04990 (SPYKS030_09230) | - | 904536..905756 (+) | 1221 | WP_011054565.1 | phage portal protein | - |
| SPYKS030_RS04995 (SPYKS030_09240) | - | 905734..906399 (+) | 666 | WP_011054564.1 | head maturation protease, ClpP-related | - |
| SPYKS030_RS05000 (SPYKS030_09250) | - | 906425..907609 (+) | 1185 | WP_011054563.1 | phage major capsid protein | - |
| SPYKS030_RS10330 | - | 907623..907751 (+) | 129 | WP_011054562.1 | hypothetical protein | - |
| SPYKS030_RS05005 (SPYKS030_09260) | - | 907754..908056 (+) | 303 | WP_011054561.1 | head-tail connector protein | - |
| SPYKS030_RS05010 (SPYKS030_09270) | - | 908053..908391 (+) | 339 | WP_011054560.1 | phage head closure protein | - |
| SPYKS030_RS05015 (SPYKS030_09280) | - | 908388..908765 (+) | 378 | WP_011054559.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SPYKS030_RS05020 (SPYKS030_09290) | - | 908762..909187 (+) | 426 | WP_011054558.1 | hypothetical protein | - |
| SPYKS030_RS05025 (SPYKS030_09300) | - | 909206..909817 (+) | 612 | WP_011054557.1 | major tail protein | - |
| SPYKS030_RS05030 (SPYKS030_09310) | gpG | 909870..910196 (+) | 327 | WP_011054556.1 | phage tail assembly chaperone G | - |
| SPYKS030_RS10060 | - | 910244..910393 (+) | 150 | WP_023609816.1 | hypothetical protein | - |
| SPYKS030_RS05035 (SPYKS030_09320) | - | 910406..914329 (+) | 3924 | WP_011054554.1 | phage tail tape measure protein | - |
| SPYKS030_RS05040 (SPYKS030_09330) | - | 914329..915036 (+) | 708 | WP_032462456.1 | distal tail protein Dit | - |
| SPYKS030_RS05045 (SPYKS030_09340) | - | 915033..917180 (+) | 2148 | WP_120164364.1 | phage tail spike protein | - |
| SPYKS030_RS05050 (SPYKS030_09350) | - | 917180..918289 (+) | 1110 | WP_023609821.1 | hyaluronidase HylP | - |
| SPYKS030_RS05055 (SPYKS030_09360) | - | 918299..920317 (+) | 2019 | WP_011106754.1 | gp58-like family protein | - |
| SPYKS030_RS05060 (SPYKS030_09370) | - | 920329..920760 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| SPYKS030_RS05065 (SPYKS030_09380) | - | 920763..921380 (+) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| SPYKS030_RS05070 (SPYKS030_09390) | - | 921390..921665 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| SPYKS030_RS05075 (SPYKS030_09400) | - | 921662..921889 (+) | 228 | WP_000609113.1 | phage holin | - |
| SPYKS030_RS05080 (SPYKS030_09410) | - | 922005..923213 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| SPYKS030_RS05085 (SPYKS030_09420) | - | 923329..923685 (-) | 357 | WP_011054446.1 | hypothetical protein | - |
| SPYKS030_RS05090 (SPYKS030_09430) | - | 923743..923982 (-) | 240 | WP_011054447.1 | hypothetical protein | - |
| SPYKS030_RS05095 (SPYKS030_09440) | - | 924246..924497 (-) | 252 | WP_011054448.1 | hypothetical protein | - |
| SPYKS030_RS10065 | - | 924638..924784 (-) | 147 | WP_011054449.1 | hypothetical protein | - |
| SPYKS030_RS05100 (SPYKS030_09450) | - | 924938..925147 (+) | 210 | WP_011054450.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS05105 (SPYKS030_09460) | prx | 925346..925528 (+) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
>NTDB_id=68997 SPYKS030_RS05105 WP_029714017.1 925346..925528(+) (prx) [Streptococcus pyogenes strain KS030]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=68997 SPYKS030_RS05105 WP_029714017.1 925346..925528(+) (prx) [Streptococcus pyogenes strain KS030]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |