Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYKS030_RS04265 | Genome accession | NZ_AP018337 |
| Coordinates | 765042..765224 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes strain KS030 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 730736..765224 | 765042..765224 | within | 0 |
Gene organization within MGE regions
Location: 730736..765224
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYKS030_RS04010 (SPYKS030_07270) | - | 730736..731011 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| SPYKS030_RS04015 (SPYKS030_07280) | - | 731100..732242 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| SPYKS030_RS04020 (SPYKS030_07290) | - | 732366..732884 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| SPYKS030_RS04025 (SPYKS030_07300) | - | 732896..733651 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS04030 (SPYKS030_07310) | - | 733853..734065 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS04035 (SPYKS030_07320) | - | 734335..734646 (+) | 312 | WP_010922478.1 | excisionase | - |
| SPYKS030_RS04040 (SPYKS030_07330) | - | 734648..734833 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| SPYKS030_RS10185 (SPYKS030_07340) | - | 734927..735196 (+) | 270 | WP_011106700.1 | replication protein | - |
| SPYKS030_RS04050 (SPYKS030_07350) | - | 735337..735723 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| SPYKS030_RS04055 (SPYKS030_07360) | - | 735704..735937 (+) | 234 | WP_011054762.1 | hypothetical protein | - |
| SPYKS030_RS04060 | - | 735934..736074 (+) | 141 | WP_011284979.1 | hypothetical protein | - |
| SPYKS030_RS04065 (SPYKS030_07370) | - | 736083..736289 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| SPYKS030_RS04070 (SPYKS030_07380) | - | 736345..736675 (+) | 331 | Protein_731 | hypothetical protein | - |
| SPYKS030_RS04075 (SPYKS030_07390) | - | 736678..737604 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| SPYKS030_RS04080 (SPYKS030_07400) | - | 737601..737801 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| SPYKS030_RS04085 (SPYKS030_07410) | - | 737794..738591 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| SPYKS030_RS04090 (SPYKS030_07420) | - | 738956..739351 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| SPYKS030_RS04095 (SPYKS030_07430) | - | 739348..740694 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| SPYKS030_RS04100 (SPYKS030_07440) | - | 740705..741037 (+) | 333 | WP_011054696.1 | hypothetical protein | - |
| SPYKS030_RS04105 (SPYKS030_07450) | - | 741034..741546 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| SPYKS030_RS04110 (SPYKS030_07460) | - | 741582..741899 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| SPYKS030_RS10040 | - | 741896..742051 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| SPYKS030_RS04115 (SPYKS030_07470) | - | 742048..742299 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| SPYKS030_RS04120 (SPYKS030_07480) | - | 742375..742794 (+) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| SPYKS030_RS04125 (SPYKS030_07490) | - | 742902..743246 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| SPYKS030_RS04130 (SPYKS030_07500) | - | 743394..743750 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| SPYKS030_RS04135 (SPYKS030_07510) | - | 743747..745015 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| SPYKS030_RS04140 (SPYKS030_07520) | - | 745008..746501 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| SPYKS030_RS04145 (SPYKS030_07530) | - | 746507..746731 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| SPYKS030_RS10045 | - | 746808..746960 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| SPYKS030_RS04150 (SPYKS030_07540) | - | 746953..747219 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| SPYKS030_RS04155 (SPYKS030_07550) | - | 747221..747436 (+) | 216 | WP_011106704.1 | hypothetical protein | - |
| SPYKS030_RS04160 (SPYKS030_07560) | - | 747518..748933 (+) | 1416 | WP_011054685.1 | terminase | - |
| SPYKS030_RS04165 (SPYKS030_07570) | - | 749014..749475 (+) | 462 | WP_011054684.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| SPYKS030_RS04170 (SPYKS030_07580) | - | 749500..750411 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| SPYKS030_RS04175 (SPYKS030_07590) | - | 750411..750611 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| SPYKS030_RS04180 (SPYKS030_07600) | - | 750621..751043 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| SPYKS030_RS04185 (SPYKS030_07610) | - | 751003..751341 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| SPYKS030_RS04190 (SPYKS030_07620) | - | 751334..751570 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| SPYKS030_RS04195 (SPYKS030_07630) | - | 751571..751906 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| SPYKS030_RS04200 (SPYKS030_07640) | - | 751922..752512 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| SPYKS030_RS04205 (SPYKS030_07650) | - | 752523..752786 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| SPYKS030_RS04210 (SPYKS030_07660) | - | 752801..753172 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| SPYKS030_RS04215 (SPYKS030_07670) | - | 753172..755535 (+) | 2364 | WP_011054677.1 | hypothetical protein | - |
| SPYKS030_RS04220 (SPYKS030_07680) | - | 755532..756227 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| SPYKS030_RS04225 (SPYKS030_07690) | - | 756209..758182 (+) | 1974 | WP_032461270.1 | phage tail spike protein | - |
| SPYKS030_RS04230 (SPYKS030_07700) | - | 758182..759291 (+) | 1110 | WP_032461564.1 | hyaluronoglucosaminidase | - |
| SPYKS030_RS04235 (SPYKS030_07710) | - | 759306..761087 (+) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| SPYKS030_RS04240 (SPYKS030_07720) | - | 761096..761527 (+) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| SPYKS030_RS04245 (SPYKS030_07730) | - | 761530..762144 (+) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| SPYKS030_RS04250 (SPYKS030_07740) | - | 762155..762610 (+) | 456 | WP_002983475.1 | phage holin family protein | - |
| SPYKS030_RS04255 (SPYKS030_07750) | - | 762722..763936 (+) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| SPYKS030_RS04260 (SPYKS030_07760) | - | 764181..764975 (+) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| SPYKS030_RS04265 (SPYKS030_07770) | prx | 765042..765224 (+) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=68994 SPYKS030_RS04265 WP_011054671.1 765042..765224(+) (prx) [Streptococcus pyogenes strain KS030]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=68994 SPYKS030_RS04265 WP_011054671.1 765042..765224(+) (prx) [Streptococcus pyogenes strain KS030]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |