Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYKS030_RS03725 | Genome accession | NZ_AP018337 |
| Coordinates | 672482..672664 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes strain KS030 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 631152..672664 | 672482..672664 | within | 0 |
Gene organization within MGE regions
Location: 631152..672664
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYKS030_RS03395 (SPYKS030_06040) | - | 631152..632249 (-) | 1098 | WP_015967409.1 | site-specific integrase | - |
| SPYKS030_RS03400 (SPYKS030_06050) | - | 632425..632946 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| SPYKS030_RS03405 (SPYKS030_06060) | - | 632957..633337 (-) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYKS030_RS03410 (SPYKS030_06070) | - | 633351..633704 (-) | 354 | WP_002986893.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS03415 (SPYKS030_06080) | - | 634506..634697 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| SPYKS030_RS03420 (SPYKS030_06090) | - | 634708..635436 (+) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| SPYKS030_RS10025 | - | 635469..635618 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| SPYKS030_RS03425 (SPYKS030_06100) | - | 635615..635815 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| SPYKS030_RS03430 (SPYKS030_06110) | - | 635891..636058 (+) | 168 | WP_002986885.1 | hypothetical protein | - |
| SPYKS030_RS03440 (SPYKS030_06130) | - | 636304..636561 (+) | 258 | WP_002988339.1 | hypothetical protein | - |
| SPYKS030_RS03445 (SPYKS030_06140) | - | 636590..636775 (+) | 186 | WP_011054765.1 | hypothetical protein | - |
| SPYKS030_RS03450 (SPYKS030_06150) | - | 636869..637126 (+) | 258 | WP_011106684.1 | hypothetical protein | - |
| SPYKS030_RS03455 (SPYKS030_06160) | - | 637248..637661 (+) | 414 | WP_011054763.1 | DnaD domain protein | - |
| SPYKS030_RS03460 (SPYKS030_06170) | - | 637642..637876 (+) | 235 | Protein_611 | hypothetical protein | - |
| SPYKS030_RS03465 | - | 637873..638013 (+) | 141 | WP_011284979.1 | hypothetical protein | - |
| SPYKS030_RS03470 (SPYKS030_06180) | - | 638024..638278 (+) | 255 | WP_011054761.1 | hypothetical protein | - |
| SPYKS030_RS03475 (SPYKS030_06190) | - | 638300..638782 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| SPYKS030_RS03480 (SPYKS030_06200) | - | 638783..639457 (+) | 675 | WP_011054760.1 | ERF family protein | - |
| SPYKS030_RS03485 (SPYKS030_06210) | ssbA | 639450..639869 (+) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| SPYKS030_RS03490 (SPYKS030_06220) | - | 639875..640078 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| SPYKS030_RS03495 (SPYKS030_06230) | - | 640078..640518 (+) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SPYKS030_RS03500 (SPYKS030_06240) | - | 640515..640871 (+) | 357 | WP_011054757.1 | hypothetical protein | - |
| SPYKS030_RS03505 (SPYKS030_06250) | - | 640868..641119 (+) | 252 | WP_011054756.1 | hypothetical protein | - |
| SPYKS030_RS03510 (SPYKS030_06260) | - | 641113..641397 (+) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| SPYKS030_RS03515 (SPYKS030_06270) | - | 641394..641663 (+) | 270 | WP_011054754.1 | hypothetical protein | - |
| SPYKS030_RS03520 (SPYKS030_06280) | - | 641673..642077 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| SPYKS030_RS10030 | - | 642074..642244 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| SPYKS030_RS03525 (SPYKS030_06290) | - | 642241..642747 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| SPYKS030_RS10035 | - | 642744..642914 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| SPYKS030_RS03530 (SPYKS030_06300) | - | 643188..643628 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPYKS030_RS03550 (SPYKS030_06340) | - | 644267..644524 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| SPYKS030_RS03555 (SPYKS030_06350) | - | 644605..645123 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| SPYKS030_RS03560 (SPYKS030_06360) | - | 645102..645779 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| SPYKS030_RS10135 (SPYKS030_06370) | - | 645788..646171 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| SPYKS030_RS03570 (SPYKS030_06380) | - | 646232..646609 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| SPYKS030_RS03575 (SPYKS030_06390) | - | 646651..647133 (+) | 483 | WP_015967410.1 | hypothetical protein | - |
| SPYKS030_RS03580 (SPYKS030_06400) | - | 647216..648427 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| SPYKS030_RS03585 (SPYKS030_06410) | - | 648441..649943 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| SPYKS030_RS03590 (SPYKS030_06420) | - | 649948..651426 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| SPYKS030_RS03595 (SPYKS030_06430) | - | 651398..651637 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| SPYKS030_RS03600 (SPYKS030_06440) | - | 651699..651965 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| SPYKS030_RS03605 (SPYKS030_06450) | - | 652091..652705 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| SPYKS030_RS03610 (SPYKS030_06460) | - | 652709..653527 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| SPYKS030_RS03615 (SPYKS030_06470) | - | 653581..653997 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| SPYKS030_RS03620 (SPYKS030_06480) | - | 653987..654319 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| SPYKS030_RS03625 (SPYKS030_06490) | - | 654319..654675 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| SPYKS030_RS03630 (SPYKS030_06500) | - | 654672..655070 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| SPYKS030_RS03635 (SPYKS030_06510) | - | 655070..655555 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| SPYKS030_RS03640 (SPYKS030_06520) | - | 655594..656028 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| SPYKS030_RS03645 (SPYKS030_06530) | - | 656032..656613 (+) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| SPYKS030_RS03650 (SPYKS030_06540) | - | 656603..659863 (+) | 3261 | WP_011054738.1 | tape measure protein | - |
| SPYKS030_RS03655 (SPYKS030_06550) | - | 659860..660576 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| SPYKS030_RS03660 (SPYKS030_06560) | - | 660573..662717 (+) | 2145 | WP_011054736.1 | phage tail spike protein | - |
| SPYKS030_RS03665 (SPYKS030_06570) | hylP | 662714..663727 (+) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| SPYKS030_RS03670 (SPYKS030_06580) | - | 663742..665625 (+) | 1884 | WP_011054734.1 | gp58-like family protein | - |
| SPYKS030_RS03675 (SPYKS030_06590) | - | 665637..666068 (+) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| SPYKS030_RS03680 (SPYKS030_06600) | - | 666071..666682 (+) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| SPYKS030_RS03685 (SPYKS030_06610) | - | 666693..666989 (+) | 297 | WP_011054732.1 | hypothetical protein | - |
| SPYKS030_RS03690 (SPYKS030_06620) | - | 666986..667171 (+) | 186 | WP_011054731.1 | holin | - |
| SPYKS030_RS03695 (SPYKS030_06630) | - | 667282..668484 (+) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| SPYKS030_RS03700 (SPYKS030_06640) | - | 668624..669148 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| SPYKS030_RS03705 (SPYKS030_06650) | - | 669136..670002 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| SPYKS030_RS03710 (SPYKS030_06660) | spek | 670306..671085 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| SPYKS030_RS03715 (SPYKS030_06680) | - | 671561..672136 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| SPYKS030_RS03725 (SPYKS030_06700) | prx | 672482..672664 (+) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=68991 SPYKS030_RS03725 WP_011054726.1 672482..672664(+) (prx) [Streptococcus pyogenes strain KS030]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=68991 SPYKS030_RS03725 WP_011054726.1 672482..672664(+) (prx) [Streptococcus pyogenes strain KS030]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |