Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYKS030_RS03215 | Genome accession | NZ_AP018337 |
| Coordinates | 589503..589685 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes strain KS030 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 551717..589685 | 589503..589685 | within | 0 |
Gene organization within MGE regions
Location: 551717..589685
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYKS030_RS02960 (SPYKS030_05170) | - | 551717..552883 (-) | 1167 | WP_009880742.1 | tyrosine-type recombinase/integrase | - |
| SPYKS030_RS02965 (SPYKS030_05180) | - | 553057..553647 (-) | 591 | WP_009880743.1 | hypothetical protein | - |
| SPYKS030_RS10000 | - | 553916..554068 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| SPYKS030_RS02970 (SPYKS030_05200) | - | 554079..554456 (-) | 378 | WP_032461557.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYKS030_RS02975 (SPYKS030_05210) | - | 554440..554799 (-) | 360 | WP_032461558.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS02980 (SPYKS030_05220) | - | 554988..555206 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS02985 (SPYKS030_05230) | - | 555301..555552 (+) | 252 | WP_011054822.1 | helix-turn-helix transcriptional regulator | - |
| SPYKS030_RS10005 | - | 555583..555720 (+) | 138 | WP_011054821.1 | hypothetical protein | - |
| SPYKS030_RS02990 (SPYKS030_05240) | - | 555736..556050 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| SPYKS030_RS02995 (SPYKS030_05250) | - | 556279..556761 (+) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| SPYKS030_RS03000 (SPYKS030_05260) | - | 556762..557442 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| SPYKS030_RS03005 (SPYKS030_05270) | - | 557544..558773 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| SPYKS030_RS03010 (SPYKS030_05280) | - | 558789..559247 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| SPYKS030_RS03015 (SPYKS030_05290) | - | 559250..560062 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| SPYKS030_RS10455 | - | 560052..560606 (+) | 555 | WP_011054578.1 | hypothetical protein | - |
| SPYKS030_RS03020 (SPYKS030_05300) | - | 560534..561532 (+) | 999 | WP_229309620.1 | phage/plasmid primase, P4 family | - |
| SPYKS030_RS03025 (SPYKS030_05310) | - | 561777..562097 (+) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| SPYKS030_RS03030 (SPYKS030_05320) | - | 562081..562437 (+) | 357 | WP_011054816.1 | hypothetical protein | - |
| SPYKS030_RS10390 (SPYKS030_05330) | - | 562434..562685 (+) | 252 | WP_011106665.1 | hypothetical protein | - |
| SPYKS030_RS03040 (SPYKS030_05340) | - | 562679..562963 (+) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| SPYKS030_RS03045 (SPYKS030_05350) | - | 562960..563373 (+) | 414 | WP_011054815.1 | YopX family protein | - |
| SPYKS030_RS10010 | - | 563370..563540 (+) | 171 | WP_011054814.1 | hypothetical protein | - |
| SPYKS030_RS03050 (SPYKS030_05360) | - | 563537..563821 (+) | 285 | WP_032461310.1 | hypothetical protein | - |
| SPYKS030_RS03055 (SPYKS030_05370) | - | 563824..564159 (+) | 336 | WP_011054813.1 | hypothetical protein | - |
| SPYKS030_RS03060 (SPYKS030_05380) | - | 564325..564510 (+) | 186 | WP_011054812.1 | hypothetical protein | - |
| SPYKS030_RS03065 (SPYKS030_05390) | - | 564797..565300 (+) | 504 | WP_011054811.1 | DUF1642 domain-containing protein | - |
| SPYKS030_RS10015 | - | 565297..565467 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| SPYKS030_RS03070 (SPYKS030_05400) | - | 565751..566185 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPYKS030_RS03075 (SPYKS030_05410) | - | 566795..567175 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| SPYKS030_RS03080 (SPYKS030_05420) | - | 567165..568439 (+) | 1275 | Protein_536 | PBSX family phage terminase large subunit | - |
| SPYKS030_RS03085 (SPYKS030_05430) | - | 568439..569764 (+) | 1326 | WP_032461413.1 | phage portal protein | - |
| SPYKS030_RS03090 (SPYKS030_05440) | - | 569733..570641 (+) | 909 | WP_009880264.1 | minor capsid protein | - |
| SPYKS030_RS03095 (SPYKS030_05450) | - | 570648..570914 (+) | 267 | WP_011054805.1 | hypothetical protein | - |
| SPYKS030_RS03100 (SPYKS030_05460) | - | 571064..571636 (+) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| SPYKS030_RS03105 (SPYKS030_05470) | - | 571654..572544 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| SPYKS030_RS03110 (SPYKS030_05480) | - | 572557..572850 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| SPYKS030_RS03115 (SPYKS030_05490) | - | 572864..573208 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| SPYKS030_RS03120 (SPYKS030_05500) | - | 573205..573516 (+) | 312 | WP_009880258.1 | hypothetical protein | - |
| SPYKS030_RS03125 (SPYKS030_05510) | - | 573513..573908 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| SPYKS030_RS03130 (SPYKS030_05520) | - | 573910..574320 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| SPYKS030_RS03135 (SPYKS030_05530) | - | 574332..574838 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| SPYKS030_RS03140 (SPYKS030_05540) | - | 574851..575168 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| SPYKS030_RS03145 (SPYKS030_05550) | - | 575141..575599 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| SPYKS030_RS03150 (SPYKS030_05560) | - | 575592..577397 (+) | 1806 | WP_011054802.1 | tail protein | - |
| SPYKS030_RS03155 (SPYKS030_05570) | - | 577398..578882 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| SPYKS030_RS03160 (SPYKS030_05580) | - | 578883..582323 (+) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| SPYKS030_RS03165 (SPYKS030_05590) | - | 582328..584190 (+) | 1863 | WP_011106671.1 | DUF859 family phage minor structural protein | - |
| SPYKS030_RS03170 (SPYKS030_05600) | - | 584201..584548 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| SPYKS030_RS10315 | - | 584562..584684 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| SPYKS030_RS03180 (SPYKS030_05620) | - | 585020..585352 (+) | 333 | WP_011054798.1 | phage holin | - |
| SPYKS030_RS03185 (SPYKS030_05630) | - | 585354..586118 (+) | 765 | WP_120164361.1 | CHAP domain-containing protein | - |
| SPYKS030_RS03190 (SPYKS030_05640) | - | 586130..586732 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| SPYKS030_RS03195 (SPYKS030_05650) | - | 586743..587516 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| SPYKS030_RS03200 (SPYKS030_05660) | - | 587526..587747 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| SPYKS030_RS03205 (SPYKS030_05670) | - | 587747..588406 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| SPYKS030_RS03210 (SPYKS030_05680) | speA | 588528..589283 (-) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| SPYKS030_RS03215 (SPYKS030_05690) | prx | 589503..589685 (+) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=68989 SPYKS030_RS03215 WP_011054793.1 589503..589685(+) (prx) [Streptococcus pyogenes strain KS030]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=68989 SPYKS030_RS03215 WP_011054793.1 589503..589685(+) (prx) [Streptococcus pyogenes strain KS030]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |