Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SPYKS030_RS02630 | Genome accession | NZ_AP018337 |
| Coordinates | 492060..492242 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain KS030 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 446658..492242 | 492060..492242 | within | 0 |
Gene organization within MGE regions
Location: 446658..492242
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYKS030_RS02370 (SPYKS030_04120) | fsa | 446658..447302 (+) | 645 | WP_002983569.1 | fructose-6-phosphate aldolase | - |
| SPYKS030_RS02375 (SPYKS030_04130) | tkt | 447520..449505 (+) | 1986 | WP_011054904.1 | transketolase | - |
| SPYKS030_RS02380 (SPYKS030_04140) | - | 449698..449922 (+) | 225 | WP_011054903.1 | bacteriocin immunity protein | - |
| SPYKS030_RS02385 (SPYKS030_04150) | - | 449998..450732 (+) | 735 | WP_011054902.1 | ABC transporter ATP-binding protein | - |
| SPYKS030_RS02390 (SPYKS030_04160) | - | 450737..452365 (+) | 1629 | WP_011054901.1 | ABC transporter permease | - |
| SPYKS030_RS02395 (SPYKS030_04170) | - | 452508..453596 (-) | 1089 | WP_011054900.1 | site-specific integrase | - |
| SPYKS030_RS02400 (SPYKS030_04180) | - | 453772..454323 (-) | 552 | WP_011054899.1 | hypothetical protein | - |
| SPYKS030_RS02405 (SPYKS030_04190) | - | 454334..454717 (-) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYKS030_RS02410 (SPYKS030_04200) | - | 454731..455081 (-) | 351 | WP_011184049.1 | helix-turn-helix domain-containing protein | - |
| SPYKS030_RS02415 (SPYKS030_04210) | - | 455720..455911 (+) | 192 | WP_001283052.1 | hypothetical protein | - |
| SPYKS030_RS02420 (SPYKS030_04220) | - | 455962..456162 (+) | 201 | WP_011184050.1 | hypothetical protein | - |
| SPYKS030_RS02425 (SPYKS030_04230) | - | 456250..456507 (+) | 258 | WP_011054895.1 | hypothetical protein | - |
| SPYKS030_RS02430 (SPYKS030_04240) | - | 456536..456706 (+) | 171 | WP_011054894.1 | hypothetical protein | - |
| SPYKS030_RS02435 (SPYKS030_04250) | - | 456699..456906 (+) | 208 | Protein_415 | hypothetical protein | - |
| SPYKS030_RS02440 (SPYKS030_04260) | - | 456903..457286 (+) | 384 | WP_011054892.1 | hypothetical protein | - |
| SPYKS030_RS02445 (SPYKS030_04270) | - | 457432..457635 (+) | 204 | WP_011054890.1 | hypothetical protein | - |
| SPYKS030_RS02450 (SPYKS030_04280) | - | 457723..458022 (+) | 300 | WP_000573833.1 | hypothetical protein | - |
| SPYKS030_RS02455 (SPYKS030_04290) | - | 458022..459179 (+) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| SPYKS030_RS02460 (SPYKS030_04300) | - | 459193..459756 (+) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| SPYKS030_RS02465 (SPYKS030_04310) | - | 459799..461721 (+) | 1923 | WP_011054887.1 | DNA polymerase | - |
| SPYKS030_RS02470 (SPYKS030_04320) | - | 461726..464110 (+) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| SPYKS030_RS02475 (SPYKS030_04330) | - | 464476..464751 (+) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| SPYKS030_RS02480 (SPYKS030_04340) | - | 464748..466070 (+) | 1323 | WP_011054884.1 | SNF2-related protein | - |
| SPYKS030_RS09990 | - | 466071..466241 (+) | 171 | WP_011054883.1 | hypothetical protein | - |
| SPYKS030_RS02485 (SPYKS030_04350) | - | 466234..466506 (+) | 273 | WP_011054882.1 | hypothetical protein | - |
| SPYKS030_RS02490 (SPYKS030_04360) | - | 466639..467055 (+) | 417 | WP_011054881.1 | transcriptional regulator | - |
| SPYKS030_RS02495 (SPYKS030_04370) | - | 467145..467597 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| SPYKS030_RS02500 (SPYKS030_04380) | - | 467587..468864 (+) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| SPYKS030_RS02505 (SPYKS030_04390) | - | 468880..470412 (+) | 1533 | WP_011106638.1 | phage portal protein | - |
| SPYKS030_RS02510 (SPYKS030_04400) | - | 470372..471820 (+) | 1449 | WP_011054877.1 | minor capsid protein | - |
| SPYKS030_RS02515 (SPYKS030_04410) | - | 471848..472036 (+) | 189 | WP_011054876.1 | hypothetical protein | - |
| SPYKS030_RS02520 (SPYKS030_04420) | - | 472041..472307 (+) | 267 | WP_011054875.1 | hypothetical protein | - |
| SPYKS030_RS02525 (SPYKS030_04430) | - | 472475..473044 (+) | 570 | WP_011054874.1 | DUF4355 domain-containing protein | - |
| SPYKS030_RS02530 (SPYKS030_04440) | - | 473057..473944 (+) | 888 | WP_002983429.1 | hypothetical protein | - |
| SPYKS030_RS02535 (SPYKS030_04450) | - | 473956..474312 (+) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| SPYKS030_RS02540 (SPYKS030_04460) | - | 474323..474601 (+) | 279 | WP_011054872.1 | hypothetical protein | - |
| SPYKS030_RS02545 (SPYKS030_04470) | - | 474598..474942 (+) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SPYKS030_RS02550 (SPYKS030_04480) | - | 474946..475305 (+) | 360 | WP_011054870.1 | hypothetical protein | - |
| SPYKS030_RS02555 (SPYKS030_04490) | - | 475317..475916 (+) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| SPYKS030_RS02560 (SPYKS030_04500) | - | 475970..476425 (+) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| SPYKS030_RS02565 (SPYKS030_04510) | - | 476500..476733 (+) | 234 | WP_011054867.1 | hypothetical protein | - |
| SPYKS030_RS02570 (SPYKS030_04520) | - | 476748..481130 (+) | 4383 | WP_011054866.1 | tape measure protein | - |
| SPYKS030_RS02575 (SPYKS030_04530) | - | 481142..481984 (+) | 843 | WP_011054865.1 | phage tail family protein | - |
| SPYKS030_RS02580 (SPYKS030_04540) | - | 481994..483973 (+) | 1980 | WP_011054864.1 | phage tail protein | - |
| SPYKS030_RS02585 (SPYKS030_04550) | - | 483970..484978 (+) | 1009 | Protein_446 | hyaluronoglucosaminidase | - |
| SPYKS030_RS02590 (SPYKS030_04560) | - | 484988..487003 (+) | 2016 | WP_032461307.1 | gp58-like family protein | - |
| SPYKS030_RS02595 (SPYKS030_04570) | - | 487015..487452 (+) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| SPYKS030_RS02600 (SPYKS030_04580) | - | 487449..488066 (+) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| SPYKS030_RS02605 (SPYKS030_04590) | - | 488076..488348 (+) | 273 | WP_002986916.1 | hypothetical protein | - |
| SPYKS030_RS02610 (SPYKS030_04600) | - | 488345..488572 (+) | 228 | WP_003058873.1 | phage holin | - |
| SPYKS030_RS02615 (SPYKS030_04610) | - | 488688..489890 (+) | 1203 | WP_011184057.1 | glucosaminidase domain-containing protein | - |
| SPYKS030_RS02620 (SPYKS030_04620) | - | 490212..490727 (+) | 516 | WP_023077389.1 | hypothetical protein | - |
| SPYKS030_RS02625 (SPYKS030_04630) | - | 490841..491827 (-) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| SPYKS030_RS02630 (SPYKS030_04640) | prx | 492060..492242 (+) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=68985 SPYKS030_RS02630 WP_011054856.1 492060..492242(+) (prx) [Streptococcus pyogenes strain KS030]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=68985 SPYKS030_RS02630 WP_011054856.1 492060..492242(+) (prx) [Streptococcus pyogenes strain KS030]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |