Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M3N36_RS06435 | Genome accession | NZ_CP097251 |
| Coordinates | 1259357..1259539 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 21SPY7071 isolate cerebral abscess | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1259357..1302118 | 1259357..1259539 | within | 0 |
Gene organization within MGE regions
Location: 1259357..1302118
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3N36_RS06435 (M3N36_06435) | prx | 1259357..1259539 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| M3N36_RS06440 (M3N36_06440) | entC3 | 1259652..1260434 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| M3N36_RS06445 (M3N36_06445) | - | 1260682..1261806 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| M3N36_RS06450 (M3N36_06450) | - | 1261942..1263159 (-) | 1218 | WP_032460576.1 | peptidoglycan amidohydrolase family protein | - |
| M3N36_RS06455 (M3N36_06455) | - | 1263278..1263505 (-) | 228 | WP_003058873.1 | phage holin | - |
| M3N36_RS06460 (M3N36_06460) | - | 1263502..1263777 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| M3N36_RS06465 (M3N36_06465) | - | 1263787..1264404 (-) | 618 | WP_030127708.1 | hypothetical protein | - |
| M3N36_RS06470 (M3N36_06470) | - | 1264407..1264568 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| M3N36_RS06475 (M3N36_06475) | - | 1264582..1266477 (-) | 1896 | WP_111711139.1 | gp58-like family protein | - |
| M3N36_RS06480 (M3N36_06480) | - | 1266488..1266802 (-) | 315 | WP_021340983.1 | hypothetical protein | - |
| M3N36_RS06485 (M3N36_06485) | - | 1266804..1268018 (-) | 1215 | WP_011284843.1 | hypothetical protein | - |
| M3N36_RS09685 | - | 1268015..1270126 (-) | 2112 | WP_111705991.1 | phage tail spike protein | - |
| M3N36_RS06500 (M3N36_06500) | - | 1270123..1270893 (-) | 771 | WP_030127447.1 | distal tail protein Dit | - |
| M3N36_RS06505 (M3N36_06505) | - | 1270893..1273643 (-) | 2751 | WP_080279311.1 | phage tail tape measure protein | - |
| M3N36_RS06510 (M3N36_06510) | - | 1273640..1273957 (-) | 318 | WP_030127445.1 | hypothetical protein | - |
| M3N36_RS06515 (M3N36_06515) | - | 1273978..1274346 (-) | 369 | WP_030127444.1 | tail assembly chaperone | - |
| M3N36_RS06520 (M3N36_06520) | - | 1274400..1274918 (-) | 519 | WP_030127443.1 | phage major tail protein, TP901-1 family | - |
| M3N36_RS06525 (M3N36_06525) | - | 1274906..1275304 (-) | 399 | WP_030127442.1 | DUF3168 domain-containing protein | - |
| M3N36_RS06530 (M3N36_06530) | - | 1275301..1275657 (-) | 357 | WP_030127441.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M3N36_RS06535 (M3N36_06535) | - | 1275657..1275953 (-) | 297 | WP_030127440.1 | hypothetical protein | - |
| M3N36_RS06540 (M3N36_06540) | - | 1275950..1276303 (-) | 354 | WP_030127439.1 | phage head-tail connector protein | - |
| M3N36_RS06545 (M3N36_06545) | - | 1276315..1276581 (-) | 267 | WP_030127438.1 | HeH/LEM domain-containing protein | - |
| M3N36_RS06550 (M3N36_06550) | - | 1276593..1277642 (-) | 1050 | WP_030127437.1 | major capsid protein | - |
| M3N36_RS06555 (M3N36_06555) | - | 1277645..1278025 (-) | 381 | WP_002990036.1 | structural protein | - |
| M3N36_RS06560 (M3N36_06560) | - | 1278035..1278568 (-) | 534 | WP_030127436.1 | DUF4355 domain-containing protein | - |
| M3N36_RS06565 (M3N36_06565) | - | 1278712..1278978 (-) | 267 | WP_030127435.1 | hypothetical protein | - |
| M3N36_RS06570 (M3N36_06570) | - | 1278994..1279908 (-) | 915 | WP_030127434.1 | minor capsid protein | - |
| M3N36_RS06575 (M3N36_06575) | - | 1279889..1281379 (-) | 1491 | WP_032461297.1 | phage portal protein | - |
| M3N36_RS06580 (M3N36_06580) | - | 1281391..1282698 (-) | 1308 | WP_014635515.1 | PBSX family phage terminase large subunit | - |
| M3N36_RS06585 (M3N36_06585) | - | 1282676..1283128 (-) | 453 | WP_249453248.1 | terminase small subunit | - |
| M3N36_RS06590 (M3N36_06590) | - | 1283218..1283634 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| M3N36_RS06595 (M3N36_06595) | - | 1283618..1283764 (-) | 147 | WP_023079210.1 | hypothetical protein | - |
| M3N36_RS06600 (M3N36_06600) | - | 1283767..1284039 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| M3N36_RS06605 (M3N36_06605) | - | 1284032..1284202 (-) | 171 | WP_164972002.1 | hypothetical protein | - |
| M3N36_RS06610 (M3N36_06610) | - | 1284203..1285525 (-) | 1323 | WP_030127431.1 | SNF2-related protein | - |
| M3N36_RS06615 (M3N36_06615) | - | 1285522..1285797 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| M3N36_RS06620 (M3N36_06620) | - | 1286183..1288567 (-) | 2385 | WP_085613976.1 | phage/plasmid primase, P4 family | - |
| M3N36_RS06625 (M3N36_06625) | - | 1288572..1290494 (-) | 1923 | WP_030127429.1 | DNA polymerase | - |
| M3N36_RS06630 (M3N36_06630) | - | 1290537..1291100 (-) | 564 | WP_086934854.1 | DUF2815 family protein | - |
| M3N36_RS06635 (M3N36_06635) | - | 1291109..1292266 (-) | 1158 | WP_030127428.1 | DUF2800 domain-containing protein | - |
| M3N36_RS06640 (M3N36_06640) | - | 1292266..1292565 (-) | 300 | WP_030127427.1 | hypothetical protein | - |
| M3N36_RS06645 (M3N36_06645) | - | 1292653..1292856 (-) | 204 | WP_030127426.1 | hypothetical protein | - |
| M3N36_RS06650 (M3N36_06650) | - | 1292853..1293005 (-) | 153 | WP_017647437.1 | hypothetical protein | - |
| M3N36_RS06655 (M3N36_06655) | - | 1293002..1293388 (-) | 387 | WP_249453186.1 | hypothetical protein | - |
| M3N36_RS06660 (M3N36_06660) | - | 1293385..1293588 (-) | 204 | WP_030127424.1 | hypothetical protein | - |
| M3N36_RS06665 (M3N36_06665) | - | 1293581..1293751 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| M3N36_RS06670 (M3N36_06670) | - | 1293753..1294064 (-) | 312 | WP_014411880.1 | hypothetical protein | - |
| M3N36_RS06675 (M3N36_06675) | - | 1294143..1294328 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| M3N36_RS06680 (M3N36_06680) | - | 1294495..1294734 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| M3N36_RS06685 (M3N36_06685) | - | 1294884..1295093 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| M3N36_RS06690 (M3N36_06690) | - | 1295339..1295545 (-) | 207 | WP_001157159.1 | helix-turn-helix transcriptional regulator | - |
| M3N36_RS06695 (M3N36_06695) | - | 1295619..1296101 (+) | 483 | WP_021340824.1 | hypothetical protein | - |
| M3N36_RS06700 (M3N36_06700) | - | 1296098..1296244 (-) | 147 | WP_021340823.1 | hypothetical protein | - |
| M3N36_RS06705 (M3N36_06705) | - | 1296299..1296898 (+) | 600 | WP_030127422.1 | hypothetical protein | - |
| M3N36_RS06710 (M3N36_06710) | - | 1296929..1297087 (-) | 159 | WP_076636802.1 | hypothetical protein | - |
| M3N36_RS06715 (M3N36_06715) | - | 1297477..1298235 (+) | 759 | WP_030127421.1 | S24 family peptidase | - |
| M3N36_RS06720 (M3N36_06720) | - | 1298270..1298950 (+) | 681 | WP_030127420.1 | hypothetical protein | - |
| M3N36_RS06725 (M3N36_06725) | - | 1299087..1300229 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| M3N36_RS06730 (M3N36_06730) | - | 1300319..1300594 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| M3N36_RS06735 (M3N36_06735) | - | 1300693..1301280 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| M3N36_RS06740 (M3N36_06740) | - | 1301258..1302100 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=688043 M3N36_RS06435 WP_011017964.1 1259357..1259539(-) (prx) [Streptococcus pyogenes strain 21SPY7071 isolate cerebral abscess]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=688043 M3N36_RS06435 WP_011017964.1 1259357..1259539(-) (prx) [Streptococcus pyogenes strain 21SPY7071 isolate cerebral abscess]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |