Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | MUB28_RS03840 | Genome accession | NZ_CP094945 |
| Coordinates | 728694..728855 (-) | Length | 53 a.a. |
| NCBI ID | WP_014727422.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain VHProbi R08 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 707926..736609 | 728694..728855 | within | 0 |
Gene organization within MGE regions
Location: 707926..736609
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUB28_RS03755 (MUB28_03755) | - | 707926..708516 (+) | 591 | WP_011227082.1 | thymidine kinase | - |
| MUB28_RS03760 (MUB28_03760) | prfA | 708559..709638 (+) | 1080 | WP_002948472.1 | peptide chain release factor 1 | - |
| MUB28_RS03765 (MUB28_03765) | prmC | 709635..710468 (+) | 834 | WP_011681016.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| MUB28_RS03770 (MUB28_03770) | - | 710455..711060 (+) | 606 | WP_002948474.1 | L-threonylcarbamoyladenylate synthase | - |
| MUB28_RS03775 (MUB28_03775) | glyA | 711155..712405 (+) | 1251 | WP_014727417.1 | serine hydroxymethyltransferase | - |
| MUB28_RS03780 (MUB28_03780) | - | 712412..713389 (+) | 978 | WP_014608183.1 | nucleoid-associated protein | - |
| MUB28_RS03785 (MUB28_03785) | - | 713391..714002 (+) | 612 | WP_041827329.1 | lysozyme family protein | - |
| MUB28_RS03790 (MUB28_03790) | - | 714035..715774 (+) | 1740 | WP_011681019.1 | ABC transporter ATP-binding protein | - |
| MUB28_RS03795 (MUB28_03795) | - | 715764..717512 (+) | 1749 | WP_011681020.1 | ABC transporter ATP-binding protein | - |
| MUB28_RS03800 (MUB28_03800) | - | 717690..717821 (+) | 132 | WP_002885174.1 | teichoic acid D-Ala incorporation-associated protein DltX | - |
| MUB28_RS03805 (MUB28_03805) | dltA | 717830..719380 (+) | 1551 | WP_011681022.1 | D-alanine--poly(phosphoribitol) ligase subunit DltA | - |
| MUB28_RS03810 (MUB28_03810) | dltB | 719377..720624 (+) | 1248 | WP_014608186.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltB | - |
| MUB28_RS03815 (MUB28_03815) | dltC | 720642..720881 (+) | 240 | WP_002950439.1 | D-alanine--poly(phosphoribitol) ligase subunit DltC | - |
| MUB28_RS03820 (MUB28_03820) | dltD | 720874..722142 (+) | 1269 | WP_011681024.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltD | - |
| MUB28_RS03825 (MUB28_03825) | - | 722195..723544 (-) | 1350 | Protein_705 | IS3 family transposase | - |
| MUB28_RS03830 (MUB28_03830) | - | 723743..726379 (-) | 2637 | WP_014727421.1 | calcium-translocating P-type ATPase, PMCA-type | - |
| MUB28_RS03835 (MUB28_03835) | pabB | 726556..728274 (-) | 1719 | WP_014608193.1 | aminodeoxychorismate synthase component I | - |
| MUB28_RS03840 (MUB28_03840) | prx | 728694..728855 (-) | 162 | WP_014727422.1 | hypothetical protein | Regulator |
| MUB28_RS03845 (MUB28_03845) | - | 729339..729614 (-) | 276 | WP_014727423.1 | hypothetical protein | - |
| MUB28_RS03850 (MUB28_03850) | - | 729631..729813 (-) | 183 | WP_014727424.1 | hypothetical protein | - |
| MUB28_RS03855 (MUB28_03855) | - | 730142..731215 (-) | 1074 | WP_014727425.1 | VapE domain-containing protein | - |
| MUB28_RS03860 (MUB28_03860) | - | 731551..732408 (-) | 858 | WP_014727426.1 | primase alpha helix C-terminal domain-containing protein | - |
| MUB28_RS03865 (MUB28_03865) | - | 732423..732695 (-) | 273 | WP_011227098.1 | MerR family transcriptional regulator | - |
| MUB28_RS03870 (MUB28_03870) | - | 732697..733038 (-) | 342 | WP_224102964.1 | hypothetical protein | - |
| MUB28_RS03875 (MUB28_03875) | - | 733025..733261 (-) | 237 | WP_014727428.1 | hypothetical protein | - |
| MUB28_RS03880 (MUB28_03880) | - | 733275..733469 (-) | 195 | WP_014727429.1 | hypothetical protein | - |
| MUB28_RS03885 (MUB28_03885) | - | 733473..733778 (-) | 306 | WP_014727430.1 | hypothetical protein | - |
| MUB28_RS03890 (MUB28_03890) | - | 733998..734195 (-) | 198 | WP_014727431.1 | helix-turn-helix transcriptional regulator | - |
| MUB28_RS03895 (MUB28_03895) | - | 734358..734876 (+) | 519 | WP_002948197.1 | helix-turn-helix transcriptional regulator | - |
| MUB28_RS03900 (MUB28_03900) | - | 734992..736158 (+) | 1167 | WP_014727432.1 | site-specific integrase | - |
| MUB28_RS03905 (MUB28_03905) | - | 736274..736609 (+) | 336 | WP_011225805.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 53 a.a. Molecular weight: 6084.95 Da Isoelectric Point: 4.2412
>NTDB_id=674404 MUB28_RS03840 WP_014727422.1 728694..728855(-) (prx) [Streptococcus thermophilus strain VHProbi R08]
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
MLTYDEFKEAMDKGFIKGDTVQIVRLDGEQVEPREILSLEKVSDIIKELGKDN
Nucleotide
Download Length: 162 bp
>NTDB_id=674404 MUB28_RS03840 WP_014727422.1 728694..728855(-) (prx) [Streptococcus thermophilus strain VHProbi R08]
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
ATGCTGACTTATGATGAATTTAAAGAGGCAATGGACAAGGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGATTAGA
CGGTGAACAAGTTGAGCCACGCGAAATATTGAGCTTAGAAAAGGTATCGGATATAATAAAGGAACTAGGCAAGGACAACT
AA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
48.333 |
100 |
0.547 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
46.667 |
100 |
0.528 |
| prx | Streptococcus pyogenes MGAS315 |
45 |
100 |
0.509 |
| prx | Streptococcus pyogenes MGAS315 |
56.818 |
83.019 |
0.472 |
| prx | Streptococcus pyogenes MGAS315 |
57.143 |
79.245 |
0.453 |
| prx | Streptococcus pyogenes MGAS315 |
60.526 |
71.698 |
0.434 |