NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	MUA27_RS07315	Genome accession	NZ_CP094817
Coordinates	1439896..1440213 (+)	Length	105 a.a.
NCBI ID	WP_096791889.1	Uniprot ID	-
Organism	Mammaliicoccus sciuri strain IVB6230
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1434896..1445213

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA27_RS07275 (MUA27_07265)	-	1435041..1435232 (+)	192	WP_078099923.1	YqgQ family protein	-
MUA27_RS07280 (MUA27_07270)	-	1435229..1436200 (+)	972	WP_096791886.1	ROK family glucokinase	-
MUA27_RS07285 (MUA27_07275)	-	1436200..1436514 (+)	315	WP_058611614.1	MTH1187 family thiamine-binding protein	-
MUA27_RS07290 (MUA27_07280)	-	1436544..1436783 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
MUA27_RS07295 (MUA27_07285)	-	1436881..1437513 (+)	633	WP_058611613.1	MBL fold metallo-hydrolase	-
MUA27_RS07300 (MUA27_07290)	-	1437547..1437795 (-)	249	WP_025904960.1	DUF2626 family protein	-
MUA27_RS07305 (MUA27_07295)	comGA	1437949..1438851 (+)	903	WP_096791887.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA27_RS07310 (MUA27_07300)	comGB	1438841..1439881 (+)	1041	WP_096791888.1	competence type IV pilus assembly protein ComGB	-
MUA27_RS07315 (MUA27_07305)	comGC	1439896..1440213 (+)	318	WP_096791889.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA27_RS07320 (MUA27_07310)	-	1440242..1440640 (+)	399	WP_049319406.1	hypothetical protein	-
MUA27_RS07325 (MUA27_07315)	comGE	1440627..1440905 (+)	279	WP_232196125.1	competence type IV pilus minor pilin ComGE	-
MUA27_RS07330 (MUA27_07320)	-	1440880..1441314 (+)	435	WP_096791891.1	competence type IV pilus minor pilin ComGF	-
MUA27_RS07335 (MUA27_07325)	-	1441549..1442037 (+)	489	WP_096791892.1	shikimate kinase	-
MUA27_RS07340 (MUA27_07330)	gcvT	1442230..1443318 (+)	1089	WP_058611608.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA27_RS07345 (MUA27_07335)	gcvPA	1443330..1444673 (+)	1344	WP_096791893.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11665.77 Da Isoelectric Point: 8.5043

                                >NTDB_id=673231 MUA27_RS07315 WP_096791889.1 1439896..1440213(+) (comGC) [Mammaliicoccus sciuri strain IVB6230]

MKRFKFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNFINDLISDG

YINQKQLTCKSGETITLENGEVVAH

Nucleotide

Download Length: 318 bp

                                >NTDB_id=673231 MUA27_RS07315 WP_096791889.1 1439896..1440213(+) (comGC) [Mammaliicoccus sciuri strain IVB6230]

ATGAAAAGATTTAAATTTTTAAGTAAAAAAGAAGGGTTTACATTGGTTGAAATGTTAATTGTCCTTTTAATCATAAGTAT

ATTATTGGTGATCATCATACCAAACATCAGCAAGCAATCAGAGACGGTAAAAAGTACTGGATGCCAAGCACAAGTGAAAA

TGGTAGCTGGTCAAGTAGAAGCTTATACATTGAAACACGATGCTAAACCAAATTTTATAAATGATTTAATAAGTGATGGC

TATATTAACCAAAAGCAACTGACTTGTAAATCAGGAGAAACAATTACGCTAGAAAACGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-32)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	64.706	97.143	0.629
comGC	Staphylococcus aureus N315	64.706	97.143	0.629
comGC	Bacillus subtilis subsp. subtilis str. 168	46.237	88.571	0.41
comYC	Streptococcus mutans UA140	48.276	82.857	0.4
comYC	Streptococcus mutans UA159	48.276	82.857	0.4
comGC	Lactococcus lactis subsp. cremoris KW2	50	78.095	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	47.674	81.905	0.39
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362

Detailed information NTG0673231