Detailed information NTG0673199

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA23_RS07100
• Genome accession: NZ_CP094816
• Coordinates: 1397023..1397340 (+)
• Length: 105 a.a.
• NCBI ID: WP_262657651.1
• Uniprot ID: -
• Organism: Mammaliicoccus sciuri strain IVB6231
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1392023..1402340

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA23_RS07060 (MUA23_07050)	-	1392167..1392358 (+)	192	WP_078099923.1	YqgQ family protein	-
MUA23_RS07065 (MUA23_07055)	-	1392355..1393326 (+)	972	WP_048539719.1	ROK family glucokinase	-
MUA23_RS07070 (MUA23_07060)	-	1393326..1393640 (+)	315	WP_078355840.1	MTH1187 family thiamine-binding protein	-
MUA23_RS07075 (MUA23_07065)	-	1393670..1393909 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
MUA23_RS07080 (MUA23_07070)	-	1394007..1394639 (+)	633	WP_078355839.1	MBL fold metallo-hydrolase	-
MUA23_RS07085 (MUA23_07075)	-	1394674..1394922 (-)	249	WP_025904960.1	DUF2626 family protein	-
MUA23_RS07090 (MUA23_07080)	comGA	1395076..1395978 (+)	903	WP_078355838.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA23_RS07095 (MUA23_07085)	comGB	1395968..1397008 (+)	1041	WP_088592324.1	competence type IV pilus assembly protein ComGB	-
MUA23_RS07100 (MUA23_07090)	comGC	1397023..1397340 (+)	318	WP_262657651.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA23_RS07105 (MUA23_07095)	-	1397369..1397767 (+)	399	WP_262657680.1	prepilin-type cleavage/methylation domain-containing protein	-
MUA23_RS07110 (MUA23_07100)	comGE	1397751..1398032 (+)	282	WP_048539723.1	competence type IV pilus minor pilin ComGE	-
MUA23_RS07115 (MUA23_07105)	-	1398007..1398441 (+)	435	WP_078355835.1	competence type IV pilus minor pilin ComGF	-
MUA23_RS07120 (MUA23_07110)	-	1398676..1399164 (+)	489	WP_048539725.1	shikimate kinase	-
MUA23_RS07125 (MUA23_07115)	gcvT	1399357..1400445 (+)	1089	WP_078355834.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA23_RS07130 (MUA23_07120)	gcvPA	1400457..1401800 (+)	1344	WP_106417431.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11603.70 Da
• Isoelectric Point: 8.5043

>NTDB_id=673199 MUA23_RS07100 WP_262657651.1 1397023..1397340(+) (comGC) [Mammaliicoccus sciuri strain IVB6231]
MKRFKFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLVVDG
YINQKQLTCKSGETITLENGEVVAH

Nucleotide

• Length: 318 bp

>NTDB_id=673199 MUA23_RS07100 WP_262657651.1 1397023..1397340(+) (comGC) [Mammaliicoccus sciuri strain IVB6231]
ATGAAAAGATTTAAATTTTTAAGTAAAAAAGAAGGATTTACATTGGTTGAGATGCTAATTGTCCTTTTAATCATAAGTAT
ATTATTGGTGATCATCATACCAAACATAAGTAAGCAATCAGAGACTGTAAAAAGTACTGGATGCCAAGCTCAAGTGAAAA
TGGTTGCTGGTCAAGTAGAAGCTTATACATTGAAGCACGACGCTAAACCAAATTCTATAAATGATTTAGTAGTTGATGGT
TATATTAATCAAAAGCAACTGACATGTAAATCAGGTGAGACAATTACACTTGAAAATGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	64.706	97.143	0.629
comGC	Staphylococcus aureus N315	64.706	97.143	0.629
comGC	Bacillus subtilis subsp. subtilis str. 168	46.237	88.571	0.41
comYC	Streptococcus mutans UA140	49.425	82.857	0.41
comYC	Streptococcus mutans UA159	49.425	82.857	0.41
comYC	Streptococcus gordonii str. Challis substr. CH1	48.837	81.905	0.4
comGC/cglC	Streptococcus mitis NCTC 12261	46.988	79.048	0.371
comGC/cglC	Streptococcus mitis SK321	46.988	79.048	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362