Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M3B_RS05940 | Genome accession | NZ_AP014596 |
| Coordinates | 1107479..1107667 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain M3-b | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1097552..1147065 | 1107479..1107667 | within | 0 |
Gene organization within MGE regions
Location: 1097552..1147065
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3B_RS05895 (M3B_1206) | lepB | 1097552..1098109 (-) | 558 | WP_002984449.1 | signal peptidase I | - |
| M3B_RS05900 (M3B_1207) | pyk | 1098327..1099829 (-) | 1503 | WP_011054543.1 | pyruvate kinase | - |
| M3B_RS05905 (M3B_1208) | pfkA | 1099892..1100905 (-) | 1014 | WP_011054544.1 | 6-phosphofructokinase | - |
| M3B_RS05910 (M3B_1209) | - | 1100985..1104095 (-) | 3111 | WP_011054545.1 | DNA polymerase III subunit alpha | - |
| M3B_RS05915 (M3B_1210) | - | 1104279..1104650 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| M3B_RS05920 (M3B_1211) | - | 1104650..1105348 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| M3B_RS05925 (M3B_1212) | - | 1105358..1106143 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| M3B_RS05930 (M3B_1213) | - | 1106274..1106888 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| M3B_RS05940 (M3B_1215) | prx | 1107479..1107667 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| M3B_RS05945 (M3B_1216) | entC3 | 1107780..1108562 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| M3B_RS05950 (M3B_1217) | - | 1108775..1109899 (-) | 1125 | WP_011054547.1 | Fic family protein | - |
| M3B_RS05955 (M3B_1218) | - | 1110037..1111245 (-) | 1209 | WP_011054548.1 | glucosaminidase domain-containing protein | - |
| M3B_RS05960 (M3B_1219) | - | 1111361..1111588 (-) | 228 | WP_011054444.1 | phage holin | - |
| M3B_RS05965 (M3B_1220) | - | 1111585..1111857 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| M3B_RS05970 (M3B_1221) | - | 1111869..1112501 (-) | 633 | WP_011054443.1 | hypothetical protein | - |
| M3B_RS05975 (M3B_1222) | - | 1112504..1112932 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| M3B_RS05980 (M3B_1223) | - | 1112944..1114848 (-) | 1905 | WP_011054442.1 | gp58-like family protein | - |
| M3B_RS05985 (M3B_1224) | - | 1114858..1115864 (-) | 1007 | Protein_1132 | hyaluronoglucosaminidase | - |
| M3B_RS05990 (M3B_1226) | - | 1115861..1117912 (-) | 2052 | WP_041174278.1 | phage tail spike protein | - |
| M3B_RS05995 (M3B_1227) | - | 1117909..1118679 (-) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| M3B_RS06000 (M3B_1228) | - | 1118692..1122792 (-) | 4101 | WP_011054439.1 | phage tail tape measure protein | - |
| M3B_RS06010 (M3B_1230) | gpG | 1123018..1123320 (-) | 303 | WP_011017390.1 | phage tail assembly chaperone G | - |
| M3B_RS06015 (M3B_1231) | - | 1123413..1123997 (-) | 585 | WP_011017389.1 | major tail protein | - |
| M3B_RS06020 (M3B_1232) | - | 1124009..1124389 (-) | 381 | WP_011017388.1 | hypothetical protein | - |
| M3B_RS06025 (M3B_1233) | - | 1124382..1124780 (-) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| M3B_RS06030 (M3B_1234) | - | 1124782..1125144 (-) | 363 | WP_011017386.1 | hypothetical protein | - |
| M3B_RS06035 (M3B_1235) | - | 1125137..1125445 (-) | 309 | WP_011054437.1 | hypothetical protein | - |
| M3B_RS10065 (M3B_1236) | - | 1125445..1125618 (-) | 174 | WP_011017384.1 | hypothetical protein | - |
| M3B_RS06040 (M3B_1237) | - | 1125632..1126765 (-) | 1134 | WP_011017383.1 | phage major capsid protein | - |
| M3B_RS06045 (M3B_1238) | - | 1126782..1127588 (-) | 807 | WP_011017382.1 | head maturation protease, ClpP-related | - |
| M3B_RS06050 (M3B_1239) | - | 1127569..1128756 (-) | 1188 | WP_011017381.1 | phage portal protein | - |
| M3B_RS06055 (M3B_1240) | - | 1128909..1129121 (-) | 213 | WP_136260634.1 | hypothetical protein | - |
| M3B_RS06060 (M3B_1241) | - | 1129124..1130854 (-) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| M3B_RS06065 (M3B_1242) | - | 1130867..1131184 (-) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| M3B_RS06070 | - | 1131325..1131630 (-) | 306 | WP_011017378.1 | HNH endonuclease | - |
| M3B_RS06075 (M3B_1244) | - | 1131623..1132009 (-) | 387 | WP_011017377.1 | hypothetical protein | - |
| M3B_RS06080 (M3B_1245) | - | 1132035..1132238 (-) | 204 | WP_011017376.1 | hypothetical protein | - |
| M3B_RS06085 (M3B_1246) | - | 1132296..1132589 (-) | 294 | WP_011017375.1 | hypothetical protein | - |
| M3B_RS06090 (M3B_1247) | - | 1132743..1133318 (-) | 576 | WP_011054435.1 | site-specific integrase | - |
| M3B_RS06095 (M3B_1248) | - | 1133478..1133879 (-) | 402 | WP_011017373.1 | hypothetical protein | - |
| M3B_RS06100 (M3B_1249) | - | 1133894..1134721 (-) | 828 | WP_011054433.1 | prohibitin family protein | - |
| M3B_RS06105 (M3B_1250) | - | 1134723..1135061 (-) | 339 | WP_011054432.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS06110 | - | 1135058..1135339 (-) | 282 | WP_011054431.1 | hypothetical protein | - |
| M3B_RS06115 (M3B_1251) | - | 1135354..1135545 (-) | 192 | Protein_1158 | single-stranded DNA-binding protein | - |
| M3B_RS06120 (M3B_1252) | - | 1135505..1136017 (-) | 513 | WP_011054429.1 | DUF1642 domain-containing protein | - |
| M3B_RS06125 (M3B_1253) | - | 1136022..1136654 (-) | 633 | WP_011054428.1 | N-6 DNA methylase | - |
| M3B_RS06130 (M3B_1254) | - | 1136656..1136940 (-) | 285 | WP_011054427.1 | hypothetical protein | - |
| M3B_RS06135 (M3B_1255) | - | 1136937..1137371 (-) | 435 | WP_011054426.1 | YopX family protein | - |
| M3B_RS06140 (M3B_1256) | - | 1137388..1137594 (-) | 207 | WP_011054425.1 | hypothetical protein | - |
| M3B_RS06145 (M3B_1257) | - | 1137608..1137835 (-) | 228 | WP_011054424.1 | hypothetical protein | - |
| M3B_RS10190 (M3B_1258) | - | 1137835..1138647 (-) | 813 | Protein_1165 | ATP-binding protein | - |
| M3B_RS06155 (M3B_1259) | - | 1138647..1139408 (-) | 762 | WP_011054422.1 | conserved phage C-terminal domain-containing protein | - |
| M3B_RS06160 (M3B_1260) | dnaB | 1139401..1140741 (-) | 1341 | WP_011017360.1 | replicative DNA helicase | - |
| M3B_RS06165 | - | 1140728..1140916 (-) | 189 | WP_032461348.1 | hypothetical protein | - |
| M3B_RS06170 (M3B_1262) | - | 1141037..1141228 (-) | 192 | WP_011017359.1 | hypothetical protein | - |
| M3B_RS06175 (M3B_1263) | - | 1141321..1141578 (-) | 258 | WP_011054421.1 | hypothetical protein | - |
| M3B_RS06180 (M3B_1264) | - | 1141652..1142371 (-) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| M3B_RS06185 | - | 1142413..1142922 (+) | 510 | WP_011106801.1 | hypothetical protein | - |
| M3B_RS10315 (M3B_1265) | - | 1143042..1143176 (-) | 135 | WP_011017356.1 | hypothetical protein | - |
| M3B_RS06190 (M3B_1266) | - | 1143250..1143462 (-) | 213 | WP_011054420.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS06195 (M3B_1267) | - | 1143497..1143772 (-) | 276 | WP_011017354.1 | hypothetical protein | - |
| M3B_RS06200 (M3B_1268) | - | 1144061..1144411 (+) | 351 | WP_011017353.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS06205 (M3B_1269) | - | 1144415..1144807 (+) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M3B_RS06210 (M3B_1270) | - | 1144818..1145558 (+) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| M3B_RS06215 (M3B_1271) | - | 1145869..1147065 (+) | 1197 | WP_011017350.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=66109 M3B_RS05940 WP_011054546.1 1107479..1107667(-) (prx) [Streptococcus pyogenes strain M3-b]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=66109 M3B_RS05940 WP_011054546.1 1107479..1107667(-) (prx) [Streptococcus pyogenes strain M3-b]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |