Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M3B_RS05010 | Genome accession | NZ_AP014596 |
| Coordinates | 919220..919402 (+) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes strain M3-b | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 878648..919021 | 919220..919402 | flank | 199 |
Gene organization within MGE regions
Location: 878648..919402
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3B_RS04730 (M3B_0969) | - | 878648..879736 (-) | 1089 | WP_011054595.1 | site-specific integrase | - |
| M3B_RS04735 | - | 879856..880161 (-) | 306 | WP_011106738.1 | membrane protein | - |
| M3B_RS04740 (M3B_0971) | - | 880171..880959 (-) | 789 | WP_021340822.1 | S24 family peptidase | - |
| M3B_RS04745 (M3B_0972) | - | 881330..881476 (+) | 147 | WP_011054593.1 | hypothetical protein | - |
| M3B_RS04750 (M3B_0973) | - | 881610..882389 (-) | 780 | WP_011054591.1 | hypothetical protein | - |
| M3B_RS04755 (M3B_0974) | - | 882446..882652 (+) | 207 | WP_011054590.1 | hypothetical protein | - |
| M3B_RS04760 (M3B_0975) | - | 882641..883027 (-) | 387 | WP_011054589.1 | hypothetical protein | - |
| M3B_RS04765 (M3B_0976) | - | 883101..883340 (+) | 240 | WP_011054588.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS04775 (M3B_0978) | - | 883556..883765 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| M3B_RS04780 (M3B_0979) | - | 883916..884155 (-) | 240 | WP_011054586.1 | hypothetical protein | - |
| M3B_RS04785 (M3B_0980) | - | 884322..884507 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS04790 (M3B_0981) | - | 884585..884881 (+) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| M3B_RS10300 (M3B_0982) | - | 884878..885012 (+) | 135 | WP_002995985.1 | hypothetical protein | - |
| M3B_RS04795 (M3B_0983) | - | 885028..885342 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| M3B_RS04800 (M3B_0985) | - | 885571..886054 (+) | 484 | Protein_895 | siphovirus Gp157 family protein | - |
| M3B_RS04805 (M3B_0986) | - | 886055..886735 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| M3B_RS04810 (M3B_0987) | - | 886837..888066 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| M3B_RS04815 (M3B_0988) | - | 888082..888540 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| M3B_RS04820 (M3B_0989) | - | 888543..889355 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| M3B_RS10435 (M3B_0990) | - | 889345..889899 (+) | 555 | WP_011054578.1 | hypothetical protein | - |
| M3B_RS04825 (M3B_0991) | - | 889827..890819 (+) | 993 | WP_229309934.1 | phage/plasmid primase, P4 family | - |
| M3B_RS04830 (M3B_0992) | - | 891081..891494 (+) | 414 | WP_008087509.1 | hypothetical protein | - |
| M3B_RS04835 (M3B_0993) | - | 891491..891811 (+) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| M3B_RS04840 (M3B_0994) | - | 891795..891998 (+) | 204 | WP_011054575.1 | hypothetical protein | - |
| M3B_RS04845 | - | 891995..892279 (+) | 285 | WP_011106747.1 | hypothetical protein | - |
| M3B_RS04850 (M3B_0995) | - | 892304..892678 (+) | 375 | WP_011054574.1 | methyltransferase domain-containing protein | - |
| M3B_RS04855 (M3B_0996) | - | 892869..893270 (+) | 402 | WP_011054573.1 | hypothetical protein | - |
| M3B_RS04860 (M3B_0997) | - | 893270..893905 (+) | 636 | WP_011054572.1 | N-6 DNA methylase | - |
| M3B_RS04865 (M3B_0998) | - | 894178..894618 (+) | 441 | WP_011054571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M3B_RS04875 (M3B_0999) | - | 895204..895542 (+) | 339 | WP_002985375.1 | HNH endonuclease | - |
| M3B_RS04880 (M3B_1000) | - | 895714..896181 (+) | 468 | WP_011054569.1 | phage terminase small subunit P27 family | - |
| M3B_RS04885 (M3B_1001) | - | 896196..897950 (+) | 1755 | WP_011054568.1 | terminase large subunit | - |
| M3B_RS10045 (M3B_1002) | - | 897947..898117 (+) | 171 | WP_011054567.1 | hypothetical protein | - |
| M3B_RS04890 (M3B_1003) | - | 898110..898376 (+) | 267 | WP_011054566.1 | hypothetical protein | - |
| M3B_RS04895 (M3B_1004) | - | 898410..899630 (+) | 1221 | WP_011054565.1 | phage portal protein | - |
| M3B_RS04900 (M3B_1005) | - | 899608..900273 (+) | 666 | WP_011054564.1 | head maturation protease, ClpP-related | - |
| M3B_RS04905 (M3B_1006) | - | 900299..901483 (+) | 1185 | WP_011054563.1 | phage major capsid protein | - |
| M3B_RS10305 (M3B_1007) | - | 901497..901625 (+) | 129 | WP_011054562.1 | hypothetical protein | - |
| M3B_RS04910 (M3B_1008) | - | 901628..901930 (+) | 303 | WP_011054561.1 | head-tail connector protein | - |
| M3B_RS04915 | - | 901927..902265 (+) | 339 | WP_011054560.1 | phage head closure protein | - |
| M3B_RS04920 (M3B_1009) | - | 902262..902639 (+) | 378 | WP_011054559.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| M3B_RS04925 (M3B_1010) | - | 902636..903061 (+) | 426 | WP_011054558.1 | hypothetical protein | - |
| M3B_RS04930 (M3B_1011) | - | 903080..903691 (+) | 612 | WP_011054557.1 | major tail protein | - |
| M3B_RS04935 (M3B_1012) | gpG | 903744..904070 (+) | 327 | WP_011054556.1 | phage tail assembly chaperone G | - |
| M3B_RS10050 (M3B_1013) | - | 904118..904267 (+) | 150 | WP_023609816.1 | hypothetical protein | - |
| M3B_RS04940 (M3B_1014) | - | 904280..908203 (+) | 3924 | WP_011054554.1 | phage tail tape measure protein | - |
| M3B_RS04945 (M3B_1015) | - | 908203..908910 (+) | 708 | WP_011054553.1 | distal tail protein Dit | - |
| M3B_RS04950 (M3B_1016) | - | 908907..911054 (+) | 2148 | WP_023605202.1 | phage tail spike protein | - |
| M3B_RS04955 (M3B_1017) | - | 911054..912163 (+) | 1110 | WP_023609821.1 | hyaluronidase HylP | - |
| M3B_RS04960 (M3B_1018) | - | 912173..914191 (+) | 2019 | WP_011106754.1 | gp58-like family protein | - |
| M3B_RS04965 (M3B_1019) | - | 914203..914634 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| M3B_RS04970 (M3B_1020) | - | 914637..915254 (+) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| M3B_RS04975 (M3B_1021) | - | 915264..915539 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| M3B_RS04980 (M3B_1022) | - | 915536..915763 (+) | 228 | WP_000609113.1 | phage holin | - |
| M3B_RS04985 (M3B_1023) | - | 915879..917087 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| M3B_RS04990 (M3B_1024) | - | 917203..917559 (-) | 357 | WP_011054446.1 | hypothetical protein | - |
| M3B_RS04995 (M3B_1025) | - | 917617..917856 (-) | 240 | WP_011054447.1 | hypothetical protein | - |
| M3B_RS05000 (M3B_1026) | - | 918120..918371 (-) | 252 | WP_011054448.1 | hypothetical protein | - |
| M3B_RS10055 (M3B_1027) | - | 918512..918658 (-) | 147 | WP_011054449.1 | hypothetical protein | - |
| M3B_RS05005 (M3B_1028) | - | 918812..919021 (+) | 210 | WP_011054450.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS05010 | prx | 919220..919402 (+) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
>NTDB_id=66105 M3B_RS05010 WP_029714017.1 919220..919402(+) (prx) [Streptococcus pyogenes strain M3-b]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=66105 M3B_RS05010 WP_029714017.1 919220..919402(+) (prx) [Streptococcus pyogenes strain M3-b]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |