Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M3B_RS04190 | Genome accession | NZ_AP014596 |
| Coordinates | 758918..759100 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes strain M3-b | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 719269..759100 | 758918..759100 | within | 0 |
Gene organization within MGE regions
Location: 719269..759100
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3B_RS03910 (M3B_0793) | recN | 719269..720930 (+) | 1662 | WP_002983909.1 | DNA repair protein RecN | - |
| M3B_RS03915 (M3B_0794) | - | 721102..722046 (+) | 945 | WP_011054704.1 | LPXTG cell wall anchor domain-containing protein | - |
| M3B_RS03920 (M3B_0795) | - | 722274..723113 (+) | 840 | WP_011054703.1 | DegV family protein | - |
| M3B_RS03925 (M3B_0796) | - | 723106..723948 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| M3B_RS03930 (M3B_0797) | - | 723926..724513 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| M3B_RS03935 (M3B_0798) | - | 724612..724887 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| M3B_RS03940 (M3B_0799) | - | 724976..726118 (-) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| M3B_RS03945 (M3B_0800) | - | 726242..726760 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| M3B_RS03950 (M3B_0801) | - | 726772..727527 (-) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS03955 (M3B_0802) | - | 727729..727941 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS03960 (M3B_0803) | - | 728211..728522 (+) | 312 | WP_010922478.1 | excisionase | - |
| M3B_RS03965 (M3B_0804) | - | 728524..728709 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| M3B_RS10160 | - | 728803..729072 (+) | 270 | WP_011106700.1 | replication protein | - |
| M3B_RS03975 (M3B_0805) | - | 729213..729599 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| M3B_RS03980 (M3B_0806) | - | 729580..729813 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| M3B_RS03985 (M3B_0807) | - | 729810..729950 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| M3B_RS03990 (M3B_0808) | - | 729959..730165 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| M3B_RS03995 | - | 730221..730551 (+) | 331 | Protein_732 | hypothetical protein | - |
| M3B_RS04000 (M3B_0811) | - | 730554..731480 (+) | 927 | WP_011054700.1 | recombinase RecT | - |
| M3B_RS04005 (M3B_0812) | - | 731477..731677 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| M3B_RS04010 (M3B_0813) | - | 731670..732467 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| M3B_RS04015 (M3B_0814) | - | 732832..733227 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| M3B_RS04020 (M3B_0815) | - | 733224..734570 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| M3B_RS04025 (M3B_0816) | - | 734581..734913 (+) | 333 | WP_011054696.1 | hypothetical protein | - |
| M3B_RS04030 (M3B_0817) | - | 734910..735422 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| M3B_RS04035 (M3B_0818) | - | 735458..735775 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| M3B_RS10030 (M3B_0819) | - | 735772..735927 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| M3B_RS04040 (M3B_0820) | - | 735924..736175 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| M3B_RS04045 (M3B_0821) | - | 736251..736670 (+) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| M3B_RS04050 | - | 736778..737122 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| M3B_RS04055 (M3B_0822) | - | 737270..737626 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| M3B_RS04060 (M3B_0823) | - | 737623..738891 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| M3B_RS04065 (M3B_0824) | - | 738884..740377 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| M3B_RS04070 (M3B_0825) | - | 740383..740607 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| M3B_RS10035 (M3B_0826) | - | 740684..740836 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| M3B_RS04075 (M3B_0827) | - | 740829..741095 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| M3B_RS04080 (M3B_0828) | - | 741097..741312 (+) | 216 | WP_011106704.1 | hypothetical protein | - |
| M3B_RS04085 (M3B_0829) | - | 741394..742809 (+) | 1416 | WP_011054685.1 | terminase | - |
| M3B_RS04090 (M3B_0830) | - | 742890..743351 (+) | 462 | WP_011054684.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| M3B_RS04095 (M3B_0831) | - | 743376..744287 (+) | 912 | WP_011054683.1 | phage major capsid protein | - |
| M3B_RS04100 (M3B_0832) | - | 744287..744487 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| M3B_RS04105 (M3B_0833) | - | 744497..744919 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| M3B_RS04110 (M3B_0834) | - | 744879..745217 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| M3B_RS04115 (M3B_0835) | - | 745210..745446 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| M3B_RS04120 (M3B_0836) | - | 745447..745782 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| M3B_RS04125 (M3B_0837) | - | 745798..746388 (+) | 591 | WP_011054679.1 | hypothetical protein | - |
| M3B_RS04130 (M3B_0838) | - | 746399..746662 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| M3B_RS04135 (M3B_0839) | - | 746677..747048 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| M3B_RS04140 (M3B_0840) | - | 747048..749411 (+) | 2364 | WP_011054677.1 | hypothetical protein | - |
| M3B_RS04145 (M3B_0841) | - | 749408..750103 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| M3B_RS04150 (M3B_0842) | - | 750085..752058 (+) | 1974 | WP_011054676.1 | phage tail spike protein | - |
| M3B_RS04155 (M3B_0843) | - | 752058..753167 (+) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| M3B_RS04160 (M3B_0844) | - | 753182..754963 (+) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| M3B_RS04165 (M3B_0845) | - | 754972..755403 (+) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| M3B_RS04170 (M3B_0846) | - | 755406..756020 (+) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| M3B_RS04175 (M3B_0847) | - | 756031..756486 (+) | 456 | WP_002983475.1 | phage holin family protein | - |
| M3B_RS04180 (M3B_0848) | - | 756598..757812 (+) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| M3B_RS04185 (M3B_0849) | - | 758057..758851 (+) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| M3B_RS04190 (M3B_0850) | prx | 758918..759100 (+) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=66102 M3B_RS04190 WP_011054671.1 758918..759100(+) (prx) [Streptococcus pyogenes strain M3-b]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=66102 M3B_RS04190 WP_011054671.1 758918..759100(+) (prx) [Streptococcus pyogenes strain M3-b]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |