Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | M3B_RS03650 | Genome accession | NZ_AP014596 |
| Coordinates | 666358..666540 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054726.1 | Uniprot ID | A0A5S4TS04 |
| Organism | Streptococcus pyogenes strain M3-b | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 625029..666540 | 666358..666540 | within | 0 |
Gene organization within MGE regions
Location: 625029..666540
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3B_RS03310 (M3B_0682) | - | 625029..626126 (-) | 1098 | WP_015967409.1 | site-specific integrase | - |
| M3B_RS03315 (M3B_0683) | - | 626302..626823 (-) | 522 | WP_002986895.1 | hypothetical protein | - |
| M3B_RS03320 (M3B_0684) | - | 626834..627214 (-) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M3B_RS03325 (M3B_0685) | - | 627228..627581 (-) | 354 | WP_002986893.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS03330 (M3B_0686) | - | 628383..628574 (+) | 192 | WP_002986891.1 | hypothetical protein | - |
| M3B_RS03335 (M3B_0687) | - | 628585..629313 (+) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| M3B_RS10020 (M3B_0688) | - | 629346..629495 (+) | 150 | WP_002986888.1 | hypothetical protein | - |
| M3B_RS03340 (M3B_0689) | - | 629492..629692 (-) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| M3B_RS03345 (M3B_0690) | - | 629768..629935 (+) | 168 | WP_002986885.1 | hypothetical protein | - |
| M3B_RS03355 (M3B_0691) | - | 630181..630438 (+) | 258 | WP_002988339.1 | hypothetical protein | - |
| M3B_RS03360 (M3B_0692) | - | 630467..630652 (+) | 186 | WP_011054765.1 | hypothetical protein | - |
| M3B_RS03365 (M3B_0693) | - | 630746..631003 (+) | 258 | WP_011106684.1 | hypothetical protein | - |
| M3B_RS03370 (M3B_0694) | - | 631125..631538 (+) | 414 | WP_011054763.1 | DnaD domain protein | - |
| M3B_RS03375 | - | 631519..631752 (+) | 234 | WP_011054762.1 | hypothetical protein | - |
| M3B_RS03380 | - | 631749..631889 (+) | 141 | WP_011284979.1 | hypothetical protein | - |
| M3B_RS03385 (M3B_0695) | - | 631900..632154 (+) | 255 | WP_011054761.1 | hypothetical protein | - |
| M3B_RS03390 (M3B_0696) | - | 632176..632658 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| M3B_RS03395 (M3B_0697) | - | 632659..633333 (+) | 675 | WP_011054760.1 | ERF family protein | - |
| M3B_RS03400 (M3B_0698) | ssbA | 633326..633745 (+) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| M3B_RS03405 | - | 633751..633954 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| M3B_RS03410 (M3B_0699) | - | 633954..634394 (+) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M3B_RS03415 (M3B_0700) | - | 634391..634747 (+) | 357 | WP_011054757.1 | hypothetical protein | - |
| M3B_RS03420 | - | 634744..634995 (+) | 252 | WP_011054756.1 | hypothetical protein | - |
| M3B_RS03425 (M3B_0701) | - | 634989..635273 (+) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| M3B_RS03430 (M3B_0702) | - | 635270..635539 (+) | 270 | WP_011054754.1 | hypothetical protein | - |
| M3B_RS03435 (M3B_0703) | - | 635549..635953 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| M3B_RS09900 (M3B_0704) | - | 635950..636120 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| M3B_RS03445 (M3B_0705) | - | 636117..636623 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| M3B_RS10025 | - | 636620..636790 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| M3B_RS03450 (M3B_0706) | - | 637064..637504 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M3B_RS03470 | - | 638143..638400 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| M3B_RS03475 (M3B_0707) | - | 638481..638999 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| M3B_RS03480 (M3B_0708) | - | 638978..639655 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| M3B_RS10110 (M3B_0709) | - | 639664..640047 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| M3B_RS03490 (M3B_0710) | - | 640108..640485 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| M3B_RS03495 (M3B_0711) | - | 640527..641009 (+) | 483 | WP_015967410.1 | hypothetical protein | - |
| M3B_RS03500 (M3B_0712) | - | 641092..642303 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| M3B_RS03505 (M3B_0713) | - | 642317..643819 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| M3B_RS03510 (M3B_0714) | - | 643824..645302 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| M3B_RS03515 (M3B_0715) | - | 645274..645513 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| M3B_RS03520 (M3B_0716) | - | 645575..645841 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| M3B_RS03525 (M3B_0717) | - | 645967..646581 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| M3B_RS03530 (M3B_0718) | - | 646585..647403 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| M3B_RS03535 (M3B_0719) | - | 647457..647873 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| M3B_RS03540 (M3B_0720) | - | 647863..648195 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| M3B_RS03545 (M3B_0721) | - | 648195..648551 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| M3B_RS03550 (M3B_0722) | - | 648548..648946 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| M3B_RS03555 (M3B_0723) | - | 648946..649431 (+) | 486 | WP_011054741.1 | phage tail tube protein | - |
| M3B_RS03560 (M3B_0724) | - | 649470..649904 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| M3B_RS03565 (M3B_0725) | - | 649908..650489 (+) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| M3B_RS03570 (M3B_0726) | - | 650479..653739 (+) | 3261 | WP_011054738.1 | tape measure protein | - |
| M3B_RS03575 (M3B_0727) | - | 653736..654452 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| M3B_RS03580 (M3B_0728) | - | 654449..656593 (+) | 2145 | WP_096404063.1 | phage tail spike protein | - |
| M3B_RS03585 (M3B_0729) | hylP | 656590..657603 (+) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| M3B_RS03590 (M3B_0730) | - | 657618..659501 (+) | 1884 | WP_096404065.1 | gp58-like family protein | - |
| M3B_RS03595 (M3B_0731) | - | 659513..659944 (+) | 432 | WP_096404067.1 | DUF1617 family protein | - |
| M3B_RS03600 (M3B_0732) | - | 659947..660558 (+) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| M3B_RS03605 (M3B_0733) | - | 660569..660865 (+) | 297 | WP_011054732.1 | hypothetical protein | - |
| M3B_RS03610 (M3B_0734) | - | 660862..661047 (+) | 186 | WP_011054731.1 | holin | - |
| M3B_RS03615 (M3B_0735) | - | 661158..662360 (+) | 1203 | WP_096404069.1 | glucosaminidase domain-containing protein | - |
| M3B_RS03620 (M3B_0736) | - | 662500..663024 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| M3B_RS03625 (M3B_0737) | - | 663012..663878 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| M3B_RS03630 (M3B_0738) | spek | 664182..664961 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| M3B_RS03640 (M3B_0739) | - | 665437..666012 (+) | 576 | WP_011054727.1 | hypothetical protein | - |
| M3B_RS03650 (M3B_0740) | prx | 666358..666540 (+) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6771.70 Da Isoelectric Point: 3.9944
>NTDB_id=66099 M3B_RS03650 WP_011054726.1 666358..666540(+) (prx) [Streptococcus pyogenes strain M3-b]
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
MLTYDEFKQAIDNGYIVGDTVAIVRKNGQIFDYVLPGEKVRPSEVVAEEIVEEVVVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=66099 M3B_RS03650 WP_011054726.1 666358..666540(+) (prx) [Streptococcus pyogenes strain M3-b]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGTAGGAGACACAGTAGCGATTGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCTGGCGAAAAAGTCAGACCGTCGGAGGTTGTGGCTGAGGAAATAGTGGAAGAGG
TGGTGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |