Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | M3B_RS03130 | Genome accession | NZ_AP014596 |
| Coordinates | 583380..583562 (+) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes strain M3-b | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 545594..583562 | 583380..583562 | within | 0 |
Gene organization within MGE regions
Location: 545594..583562
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3B_RS02875 (M3B_0587) | - | 545594..546760 (-) | 1167 | WP_009880742.1 | tyrosine-type recombinase/integrase | - |
| M3B_RS02880 (M3B_0589) | - | 546934..547395 (-) | 462 | WP_011106661.1 | hypothetical protein | - |
| M3B_RS09995 (M3B_0591) | - | 547792..547944 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| M3B_RS02885 (M3B_0592) | - | 547955..548332 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| M3B_RS02890 (M3B_0593) | - | 548316..548675 (-) | 360 | WP_011054823.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS02895 (M3B_0594) | - | 548864..549082 (+) | 219 | WP_009881062.1 | helix-turn-helix domain-containing protein | - |
| M3B_RS02900 (M3B_0595) | - | 549177..549428 (+) | 252 | WP_011054822.1 | helix-turn-helix transcriptional regulator | - |
| M3B_RS10000 (M3B_0596) | - | 549459..549596 (+) | 138 | WP_011054821.1 | hypothetical protein | - |
| M3B_RS02905 (M3B_0597) | - | 549612..549926 (+) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| M3B_RS02910 (M3B_0599) | - | 550155..550638 (+) | 484 | Protein_517 | siphovirus Gp157 family protein | - |
| M3B_RS02915 (M3B_0600) | - | 550639..551319 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| M3B_RS02920 (M3B_0601) | - | 551421..552650 (+) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| M3B_RS02925 (M3B_0602) | - | 552666..553124 (+) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| M3B_RS02930 (M3B_0603) | - | 553127..553939 (+) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| M3B_RS10420 (M3B_0604) | - | 553929..554483 (+) | 555 | WP_011054578.1 | hypothetical protein | - |
| M3B_RS02935 (M3B_0605) | - | 554411..555409 (+) | 999 | WP_229309620.1 | phage/plasmid primase, P4 family | - |
| M3B_RS02940 (M3B_0606) | - | 555654..555974 (+) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| M3B_RS02945 (M3B_0607) | - | 555958..556314 (+) | 357 | WP_011054816.1 | hypothetical protein | - |
| M3B_RS10360 | - | 556311..556562 (+) | 252 | WP_011106665.1 | hypothetical protein | - |
| M3B_RS02955 (M3B_0608) | - | 556556..556840 (+) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| M3B_RS02960 (M3B_0609) | - | 556837..557250 (+) | 414 | WP_011054815.1 | YopX family protein | - |
| M3B_RS10005 (M3B_0610) | - | 557247..557417 (+) | 171 | WP_011054814.1 | hypothetical protein | - |
| M3B_RS02965 | - | 557414..557698 (+) | 285 | WP_032461310.1 | hypothetical protein | - |
| M3B_RS02970 (M3B_0611) | - | 557701..558036 (+) | 336 | WP_011054813.1 | hypothetical protein | - |
| M3B_RS02975 (M3B_0613) | - | 558202..558387 (+) | 186 | WP_011054812.1 | hypothetical protein | - |
| M3B_RS02980 (M3B_0614) | - | 558674..559177 (+) | 504 | WP_011054811.1 | DUF1642 domain-containing protein | - |
| M3B_RS10010 | - | 559174..559344 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| M3B_RS02985 (M3B_0616) | - | 559628..560062 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| M3B_RS02990 (M3B_0617) | - | 560672..561052 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| M3B_RS02995 | - | 561042..562316 (+) | 1275 | Protein_537 | PBSX family phage terminase large subunit | - |
| M3B_RS03000 (M3B_0620) | - | 562316..563641 (+) | 1326 | WP_032461413.1 | phage portal protein | - |
| M3B_RS03005 (M3B_0621) | - | 563610..564518 (+) | 909 | WP_009880264.1 | minor capsid protein | - |
| M3B_RS03010 (M3B_0622) | - | 564525..564791 (+) | 267 | WP_011054805.1 | hypothetical protein | - |
| M3B_RS03015 (M3B_0623) | - | 564941..565513 (+) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| M3B_RS03020 (M3B_0624) | - | 565531..566421 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| M3B_RS03025 (M3B_0625) | - | 566434..566727 (+) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| M3B_RS03030 (M3B_0626) | - | 566741..567085 (+) | 345 | WP_009880259.1 | hypothetical protein | - |
| M3B_RS03035 (M3B_0627) | - | 567082..567393 (+) | 312 | WP_009880258.1 | hypothetical protein | - |
| M3B_RS03040 (M3B_0628) | - | 567390..567785 (+) | 396 | WP_009880257.1 | hypothetical protein | - |
| M3B_RS03045 (M3B_0629) | - | 567787..568197 (+) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| M3B_RS03050 (M3B_0630) | - | 568209..568715 (+) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| M3B_RS03055 (M3B_0631) | - | 568728..569045 (+) | 318 | WP_009880254.1 | hypothetical protein | - |
| M3B_RS03060 (M3B_0632) | - | 569018..569476 (+) | 459 | WP_009880253.1 | hypothetical protein | - |
| M3B_RS03065 (M3B_0633) | - | 569469..571274 (+) | 1806 | WP_011054802.1 | tail protein | - |
| M3B_RS03070 (M3B_0634) | - | 571275..572759 (+) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| M3B_RS03075 (M3B_0635) | - | 572760..576200 (+) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| M3B_RS03080 (M3B_0636) | - | 576205..578067 (+) | 1863 | WP_011106671.1 | DUF859 family phage minor structural protein | - |
| M3B_RS03085 (M3B_0637) | - | 578078..578425 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| M3B_RS10290 (M3B_0638) | - | 578439..578561 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| M3B_RS03095 (M3B_0639) | - | 578897..579229 (+) | 333 | WP_011054798.1 | phage holin | - |
| M3B_RS03100 (M3B_0640) | - | 579231..579995 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| M3B_RS03105 (M3B_0641) | - | 580007..580609 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| M3B_RS03110 (M3B_0642) | - | 580620..581393 (+) | 774 | WP_011054795.1 | hypothetical protein | - |
| M3B_RS03115 (M3B_0643) | - | 581403..581624 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| M3B_RS03120 (M3B_0644) | - | 581624..582283 (+) | 660 | WP_009880240.1 | hypothetical protein | - |
| M3B_RS03125 (M3B_0645) | speA | 582405..583160 (-) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| M3B_RS03130 (M3B_0646) | prx | 583380..583562 (+) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=66097 M3B_RS03130 WP_011054793.1 583380..583562(+) (prx) [Streptococcus pyogenes strain M3-b]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=66097 M3B_RS03130 WP_011054793.1 583380..583562(+) (prx) [Streptococcus pyogenes strain M3-b]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |